Ändra sökning
Avgränsa sökresultatet
1234567 1 - 50 av 696
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf
Träffar per sida
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 1.
    Josefsson, Weine
    SMHI, Samhälle och säkerhet.
    Long-term global radiation in Stockholm, 1922-20182019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    År 1922 inleddes mätningar av globalstrålningen i Stockholm. Under åren har SMHI använt olika instrumenttyper, insamlingssystem och även flyttat mätplatsen inom staden. Denna typ av förändringar orsakar, små ibland större, men betydelsefulla systematiska förändringar i den uppmätta globalstrålningen. Därför kan det finnas betydande osäkerheter i direkta jämförelser av data från olika perioder. I föreliggande rapport visas hur data granskats, ibland rättats, kompletterats och korrigerats för kända mätfel till ett slutligt data-set, som förhoppningsvis bättre ska kunna användas för studier av den långsiktiga variationen av globalstrålning i Stockholm än de ursprungliga mätningarna.Under arbetet uppstod behov av att använda solskenstidsobservationer. Dessa har därför digitaliserats, granskats och vid behov rättats så att en någorlunda homogen serie erhållits på månadsnivå. Information om detta finns i Appendix 3.

  • 2.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet.

    IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom.

    I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras ävenkunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 3.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Refereegranskat)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet. IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom. I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras även kunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 4.
    Andersson, Stefan
    et al.
    SMHI, Affärsverksamhet.
    Arvelius, Johan
    SMHI, Affärsverksamhet.
    Jones, Jörgen
    SMHI, Affärsverksamhet.
    Kindell, Sven
    SMHI, Affärsverksamhet.
    Leung, Wing
    SMHI, Affärsverksamhet.
    Beräkningar av emissioner och halter avbenso(a)pyren och partiklar frånsmåskalig vedeldning: Luftkvalitetsmodellering för Skellefteå, Strömsunds och Alingsås kommuner2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna studie har emissioner och halter i utomhusluften av benso(a)pyren (B(a)P) samt partiklar (PM2.5) beräknats för Skellefteå, Strömsunds och Alingsås kommuner avseende småskalig uppvärmning. Emissioner har beräknats för hela kommunerna, medan luftkvalitet har modellerats för två tätorter i varje kommun; Boliden och Bureå i Skellefteå kommun, Backe och Hoting i Strömsunds kommun samt Alingsås och Sollebrunn i Alingsås kommun. De tre kommunerna valdes då de identifierades ha höga B(a)P-halter i den tidigare nationella B(a)P-kartläggningen samt tillgång till sotarregister av tillräcklig bra kvalitet; tätorterna valdes genom att analysera emissionsberäkningarna i varje kommun och välja ut tätorter med de högsta emissionerna.

    Syftet med studien är undersöka hur B(a)P- och PM2.5-halterna i Sverige förhåller sig till miljökvalitetsnormer, utvärderingströsklar samt preciseringen av miljökvalitetsmålet Frisk luft och analysera hur stort gapet är för att klara dessa. Detta genom spridningsmodellering samt utvärdering mot mätningar i fem av tätorterna. Osäkerheterna i den tidigare gjorda nationella karteringen av B(a)Phalter från småskalig vedeldning (Andersson et al., 2015), som ska ses som en preliminär bedömning av halterna, utvärderas också. Vidare undersöks, genom känslighetsanalys, hur antaganden om emissionsfaktorer och eldvanor påverkar luftkvaliteten i områdena. En av de åtgärder som utreds är att byta ut gamla vedpannor mot moderna eldstäder. Luftmiljövinsterna av detta undersöks också genomspridningsmodellering.

    Emissionerna från eldstäderna har beräknats utifrån information från sotarregister i de olika kommunerna, där eldstäderna har klassificerats som vedpannor (miljögodkända och ickemiljögodkända), lokaleldstäder, flis- och pelletspannor samt övriga pannor (mest oljepannor). Geolokalisering, dvs. framtagandet av koordinater, har gjorts för de olika eldstäderna i registren baserat på adresser. Med hjälp av modellerade energibehov för ett genomsnittligt meteorologiskt kalenderår för perioden 1960-1990, för ett genomsnittligt småhus, samt antaganden om emissionsfaktorer, eldstäders nyttjandegrad samt verkningsgrad har sedan emissionerna beräknats.

    Lokalskalig spridningsmodellering med en rumslig upplösning om 20 m × 20 m har genomförts för de utvalda tätorterna med den Gaussiska lokalskaliga spridningsmodellen Dispersion, som är samma lokala modell som finns i modellsystemet SIMAIR-ved. Vid spridningsmodelleringen har meteorologiska data från Mesan för kalenderår 2016 och 2017 använts. Bakgrundshalter har inkluderats för PM2.5, men enbart lokalt haltbidrag från småskalig uppvärmning har beräknats för B(a)P; ett schablontillägg av bakgrundshalter för B(a)P har gjorts för varje tätort. Modelleringen har också utvärderats mot preliminära mätresultat (månadsprovtagning) av B(a)P avseende juni- december 2017 i Boliden, Bureå, Backe, Hoting samt Alingsås tätort samt mätningar av PM2.5 i Bureå och Backe (mätningarna har utförts av Svenska Miljöinstitutet IVL på uppdrag av Naturvårdsverket)

  • 5.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2018 - Extent of Anoxia and Hypoxia, 1960-20182018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES datacenter. I denna rapport har resultaten från 2017 uppdaterats och preliminära resultat för 2018 tagits fram. Resultaten för 2018 baseras på data insamlade under internationella fiskeriundersökningar, nationell miljöövervakning och forskningsprojekt med bidrag från Danmark, Estland, Lettland, Sverige, Finland, Ryssland och Polen. Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten. Resultaten för 2017 och de preliminära resultaten för 2018 visar att de extrema syreförhållanden som observerats i Egentliga Östersjön, efter regimskiftet 1999, fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots ett flertal inflöden under perioden 2014-2016 beräknas ungefär 22% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 32% av hypoxi under 2018. De preliminära resultaten från 2018 indikerar att de anoxiska områdena är de största som har noterats under den analyserade perioden, som startar 1960. Mängden svavelväte, som på grund av inflödena 2014- 2016, helt försvann från Östra och Norra Gotlandsbassängerna, ökar åter i dessa bassängers djupvatten.

  • 6.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Wikberger, Christina
    Amorim, Jorge Humberto
    SMHI, Forskningsavdelningen, Luftmiljö.
    Klimatanpassa nordiska städer med grön infrastruktur2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Förtätning av städer och pågående klimatförändring ökar behovet av anpassningsåtgärder. Grön infrastruktur och naturbaserade lösningar kan bidra till att skapa mer hälsosamma och långsiktigt hållbara städer. För att öka användningen av grön infrastruktur som en del i klimatanpassningen behöver vi förstå vilka kunskapsluckor och andra hinder som ligger i vägen för att grön infrastruktur ska användas i klimatanpassningsarbetet.

    SMHI har under år 2018 tillsammans med Stockholms stad drivit det av forskningsrådet Formas finansierade projektet ”Grön infrastruktur och klimat i nordiska städer: idag och i framtiden”. Sammanställningen av rapporter och workshops i projektet visar att det finns mycket kunskap och tillgängliga exempel på hur urbana gröna lösningar kan se ut. Det saknas dock svar på de kvantitativa effekterna av olika åtgärder avseende till exempel temperatur, luftkvalitet, påverkan på hälsa och sociala aspekter.

    De åtgärder som i dag görs i nordiska städer baseras huvudsakligen på behovet av att lösa dagvattenfrågor. Det finns få exempel på städer som använder grön infrastruktur och naturbaserade lösningar som klimatanpassningsåtgärder när det gäller värme. Samtidigt är aktörerna medvetna om övriga positiva effekter som tillkommer såsom trivsel, svalka och biologisk mångfald.

    Eftersom grön infrastruktur och naturbaserade lösningar är ganska nya åtgärder i klimatanpassningsarbetet så saknas oftast erfarenheter av långtidseffekter. Skötsel kan vara ett problem, trots bra anvisningar. Aktörerna pekar också på behovet av att engagera de boende kontinuerligt. Det tycks handla om att skapa en djupare förståelse för varför anläggningar ser ut som de gör och hur de ska skötas.

    Vid workshops och webbinarium efterfrågades vilka kunskapsluckor deltagarna såg. Ekonomi och kunskap om effekter lyftes fram tydligt i svaren. Dessutom önskades metoder för anläggning och drift, goda exempel, planeringsverktyg och underlag om temperatur och vatten.

    Ekonomi och kunskapsbrist ansågs som hinder för genomförande, vilket framkom vid workshops och webbinarium. Andra hinder som nämndes var politiska beslut, lagstiftning, avsaknad av riktlinjer, förtätning och konkurrens om mark liksom planerings- och samordningssvårigheter. En tröghet i att ändra traditionellt planerande och utförande pekades också ut som hinder. Många efterfrågar kunskap allmänt. Vår förhoppning är att denna rapport kan bidra till att inspirera och informera om var material finns. 

  • 7.
    Karlson, Bengt
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Mohlin, Malin
    Hu, Ye O.O.
    Andersson, Anders F.
    Miljöövervakning av växtplankton i Kattegatt och Östersjön med rDNA-barcoding och mikroskopi: En jämförelse av molekylärbiologisk metodik och mikroskopi.2018Rapport (Övrigt vetenskapligt)
  • 8.
    Andersson, Camilla
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord Wylde, Helene
    SMHI, Affärsverksamhet.
    Engardt, Magnuz
    SMHI, Forskningsavdelningen, Luftmiljö.
    Long-term sulfur and nitrogen deposition in Sweden: 1983-2013 reanalysis2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Ett unikt långt dataset (1983-2013) för svavel- och kvävedeposition har skapats för Sverige samt Östersjön och omgivande länder. Det baseras på kvalitetsgranskade mätningar och modellfält, kombinerade genom avancerade metoder för att fånga spatiala och temporala variationer. Datasetet kan användas för att beskriva trender i deposition till olika relevanta marktyper.Återanalysen stämmer väl överens med mätningar, men vi har identifierat skillnader i torrdeposition till barrskog. Detta visar på behov av djupare studier och metodikförbättringar för bestämning av torrdeposition.Vi rekommenderar mer avancerade metoder för att beskriva spatial variation än genom medelvärdesbildning eller spatial interpolering av uppmätt deposition.Vi finner en markant minskning från 1980-talet fram till idag för både svavel- och kvävedeposition (med cirka 80 % respektive 30 %).Kritiska belastningar till både barr- och lövskog, fjällmarker och våtmarker har överskridits framförallt i sydvästra Sverige, men också i sydöstra Sverige och södra fjällen. Situationen förbättras men överskridanden sker fortfarande även över större områden.

  • 9.
    Leung, Wing
    et al.
    SMHI, Affärsverksamhet.
    Windmark, Fredrik
    SMHI, Affärsverksamhet.
    Brodl, Ludvik
    SMHI, Affärsverksamhet.
    Langner, Joakim
    SMHI, Forskningsavdelningen, Luftmiljö.
    A basis to estimate marginal cost for air traffic in Sweden.: Modelling of ozone, primary and secondary particles and deposition of sulfur and nitrogen.2018Rapport (Övrigt vetenskapligt)
    Abstract [en]

    In this study we have investigated the effects of emissions from aviation on air quality in both Swedish and European domains. The results will be used as a basis to estimate the marginal cost for air traffic in Sweden. The vertical, geographical and temporal distribution of aviation emissions over Sweden has been estimated using a newly developed methodology. The aviation emissions have been categorized by their emission altitude (LTO, low cruise and high cruise) and flight nationality (international, national and overflight). This aviation emission information was then used as input data to the regional atmospheric chemistry model MATCH to simulate the effects of aviation emissions on ecosystem, health and climate metrics. A total of 17 model simulations over three years have been performed. There is one simulation in which all emitted species from the surface and aviation emissions are included and eight simulations in which all aviation emissions from each combination of emission altitude and flight nationality are included. There are eight simulations in which NOx aviation emissions from each combination of emission altitude and flight nationality are included. Using these simulations, contributions from aviation emissions to deposition, concentrations and a range of different air pollution metrics has been calculated. The results are calculated in both the Europe and Swedish domains for all the simulations. 

    The following results are included in this report: . Deposition of oxidised and reduced nitrogen . Deposition of excess sulfur . AOT40 and SOMO35 and their exposures . Concentration and exposure of primary and secondary particles . Concentration of nitrate and sulfate particles . Concentration of surface and above surface ozone 

    In summary, contributions from aviation emissions in Sweden to the different concentrations, deposition and metrics for environmental effects are generally small, on the order of a few per mille or less. However the impacts can be traced in the simulations well beyond the Swedish borders. LTO emissions give the largest contribution to deposition of oxidised and reduced nitrogen, deposition of excess sulfur and concentrations of primary and secondary particles. In particular near the major airports like Stockholm-Arlanda and Gothenburg-Landvetter. High cruise emissions give insignificant contributions to deposition and concentrations at surface level. LTO emissions give a negative contribution to surface ozone concentration locally at the main Swedish airports but give an overall increased contribution in the regions around. Aviation emissions at low cruise and high cruise levels have the largest effect on ozone concentrations at higher levels. 

  • 10. Colette, Augustin
    et al.
    Schucht, Simone
    Ciarelli, Giancarlo
    Létinois, Laurent
    Meleux, Frédérik
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    Cuvelier, C.
    Manders, A.
    Mar, K.A.
    Mircea, M.
    Pay, T.
    Raffort, V.
    Tsyro, S.
    Adani, M.
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Bessagnet, G
    Briganti, A.
    Cappelletti, A.
    Couvidat, F.
    D'Isidoro, M.
    Fagerli, H.
    Ojha, N.
    Otero, N.
    Wind, P.
    Long-term air quality trends in Europe Fine Particulate Matter (PM2.5) Health Impacts.2018Rapport (Övrigt vetenskapligt)
  • 11.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    The SwedishNational MarineMonitoringProgramme 2017: HydrographyNutrientsPhytoplankton2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten sammanfattar de huvudsakliga resultaten av det svenska nationella marina övervakningsprogrammet av pelagialen under 2017. Resultat från mätningar av hydrografi, näringsämnen och växtplankton diskuteras för  haven runt Sverige; Skagerrak, Kattegatt, Öresund, Egentliga Östersjön, Bottenhavet och Bottenviken. Övervakningen utförs av SMHI (Sveriges meteorologiska och hydrologiska institut), SU (Stockholms Universitet) och UMF (Umeå marina forskningscentrum) och övervakningsprogrammet samfinansieras av HaV (Havs- och vattenmyndigheten), SMHI, SU and UMF. Data är insamlade, analyserade och rapporterade med stöd från svensk miljöövervakning och på uppdrag HaV.

    Den Baltiska strömmen längs Västkusten medför stora fluktuationer av  salthalten i ytan och det ovanligt höga utflödet med bräckt vatten från Östersjön under 2017 avspeglades som låg ytsalthalt i Skagerrak och Kattegatt i början av året. Det var inga stora djupvatteninflöden till Östersjön under 2017 men ett par av mindre storlek. Dessa mindre inflöden förbättrade syreförhållanden endast temporärt i Bornholms-bassängen och i södra delen av Östra Gotlandsbassängen.

    Salthalten under haloklinen var högre än normalt i Gotlands-bassängerna och i Norra Egentliga Östersjön samt även i ytlagret i Östra Gotlandsbassängen.

    Koncentrationen av fosfat och oorganiskt kväve i Skagerrak och Kattegatts ytvatten var normal medan silikatkoncentrationen var hög, speciellt under våren. I Östersjöns ytvatten var det höga nivåer av silikat i alla bassänger. Enligt det uppskattade totala innehållet av kisel i Östersjön har det pågått en ökning av kisel sedan början av 90-talet. Koncentrationen av fosfat i ytvattnet var över normal i Gotlandsbassängerna och Norra Egentliga Östersjön medan koncentrationen av oorganiskt kväve var mer än normalt i Arkona- och Bornholmsbassängen. Under vår och sommar var det djup där det oorganiska kvävet tar slut i Egentliga Östersjön större än normalt. I djupvattenlagret var det lägre koncentrationer än normalt av särskilt fosfat och silikat.

    I stället för de sedvanliga kiselalgerna var det det för fisk skadliga flagellatsläktet Pseudochattonella som blommade på Västkusten i februari till april. Under hösten förekom däremot en utdragen kiselalgsblomning. I Östersjön förekom vårblomningen i april. Cyanobakterieblomningen startade redan i maj med Aphanizomenon flos-aquae. Under juni och juli fanns alla tre av de filamentösa cyanobakterierna, A. flos-aquae, Dolichospermum lemmermannii och den potentiellt skadliga Nodularia spumigena, i växtplanktonproverna i varierande mängd.

    I Bottenhavet var ytvattentemperaturen lägre än normalt och koncentrationen av syre var under normala nivåer, men ändå högre än kritiska.

  • 12.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2017 - Extent of Anoxia and Hypoxia, 1960-20172018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES. I denna rapport har resultaten från 2016 uppdaterats. De preliminära resultaten för 2017 baseras på data insamlade under Baltic International Acoustic Survey (BIAS) och nationell miljöövervakning med bidrag från Sverige, Finland och Polen.

    Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten.

    Resultaten för 2016 och de preliminära resultaten för 2017 visar att de extremasyreförhållanden som observerats i Egentliga Östersjön fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots ett flertal inflöden under perioden 2014-2016 beräknas ungefär 18% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 28% av hypoxi under 2017. Inflödena 2014-2016 har minskat poolen av svavelväte så att den nästan helt försvunnit i Östra och Norra Gotlandsbassängen. Dock är syrgashalterna fortsatt noll eller mycket nära noll i djupvattnet och tecken på ökade halter av svavelväte har noterats under 2017.

  • 13.
    Lindström, Göran
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Bartosova, Alena
    SMHI, Forskningsavdelningen, Hydrologi.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Strömqvist, Johan
    SMHI, Forskningsavdelningen, Hydrologi.
    Uppehållstider i ytvatten i relation tillvattenkvalitetNET, ett generellt uppskalningsverktyg2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    NET är ett verktyg för uppskattning av vattenburen transport av olika ämnen i punkter där detsaknas mätningar. Verktyget togs ursprungligen fram inom forskningsprogrammet ”Climatechange and the Environmental Objectives” (CLEO, Munthe et al., 2014 och 2016). Tanken äratt NET ska vara generellt, och kunna användas för simulering av olika ämnen, men endastberäkna medelvärden över tiden av mängder och koncentrationer. Ofta är det mängder som ärslutmålet för en beräkning, varför det i vissa situationer kan finnas mycket att vinna på attanvända en enkel och snabb beräkningsmodell. Inom CLEO simulerades flöden av totalkväve,total-fosfor och totalt organiskt kol.

  • 14.
    Olsson, Jonas
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Berg, Peter
    SMHI, Forskningsavdelningen, Hydrologi.
    Eronn, Anna
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Simonsson, Lennart
    SMHI, Forskningsavdelningen, Hydrologi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Yang, Wei
    SMHI, Forskningsavdelningen, Hydrologi.
    Extremregn i nuvarande och framtida klimat Analyser av observationer och framtidsscenarier2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Studien har främst omfattat analyser av extrem korttidsnederbörd i observationer från SMHIs nät av automatiska meteorologiska stationer. Även analyser av korttidsnederbörd från kommunala mätare, manuella meteorologiska stationer, väderradar och klimatmodeller har genomförts. De huvudsakliga slutsatserna från detta uppdrag kan sammanfattas enligt följande.

    • En regionalisering av extrem korttidsnederbörd (skyfall) i Sverige gav fyra regioner: sydvästra (SV), sydöstra (SÖ), mellersta (M) och norra (N) Sverige. Ytterligare indelning kan göras men i denna studie prioriterades att ha regioner av denna storleksordning för att få ett ordentligt underlag för regional statistik. Regionaliseringen gäller enbart korttidsnederbörd, upp till maximalt 12 tim varaktighet.
    • Den regionala statistiken uppvisar tämligen distinkta geografiska skillnader, med högst värden i region SV och lägst i region N. Det är inte förvånande att vårt avlånga land uppvisar regionala skillnader då varmare och fuktigare luftmassor förekommer mer i söder än i norr, och därmed ökar förutsättningarna för intensiv nederbörd. Den regionala statistiken överensstämmer överlag väl med motsvarande statistik i våra grannländer.
    • Under perioden 1996-2017 finns inga tydliga tidsmässiga tendenser vad gäller skyfallens storlek och frekvens i de olika regionerna, utan dessa ligger överlag på en konstant nivå. Inte heller extrem dygnsnederbörd sedan 1900 uppvisar några tydliga tendenser på regional nivå. På nationell nivå indikeras en svag ökning av dels landets högsta årliga nederbörd sedan 1881, dels förekomsten av stora, utbredda 2-dygnsregn sedan 1961.
    • Skyfallsstatistik baserad på nederbördsobservationer från väderradar som justerats mot interpolerade stationsdata (HIPRAD) överensstämmer väl med stationsbaserad statistik för korta varaktigheter (upp till 2 tim) i södra Sverige. För längre varaktigheter och i mellersta och norra Sverige överskattar HIPRAD regnvolymerna.
    • Analyser av de senaste klimatmodellerna (Euro-CORDEX) indikerar en underskattning av extrema regnvolymer för korta varaktigheter (1 tim) men överlag en realistisk beskrivning av observerad skyfallsstatistik. Den framtida ökningen av volymerna beräknas ligga mellan 10% och 40% beroende på tidshorisont och koncentration av växthusgaser, vilket överlag ligger nära tidigare bedömningar.

    Både för bedömningen av regionala skillnader och historiska klimateffekter är det av största vikt att bibehålla, eller ännu hellre utöka, observationerna av korttidsnederbörd i Sverige. Nederbördsmätning via alternativa tekniker bör kunna användas i allt högre utsträckning framöver för förbättrad kunskap och statistik. Väderradar är redan etablerat och den digitala utvecklingen öppnar även möjligheter till insamling av nederbördsdata och relaterad information via mobilmaster, uppkopplade privata väderstationer, sociala medier, etc. Denna utveckling måste bevakas, utvärderas och i största möjliga utsträckning utnyttjas.

  • 15.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden. Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra största sjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren är mycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är det Vänern som har de största problemen i dagens klimat och fram till slutet av detta sekel, medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längre tidsperspektiv.

    Klimatförändringarna medför bland annat förändrade vattennivåer, förändrade vattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilket ger konsekvenser för olika intressen runt sjöarna.

    En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte är tydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är ett hinder för att komma vidare med de problem som idag finns för Vänern och för den långsiktiga klimatanpassningen av Mälaren, bortom detta sekel.

    Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring:

    • Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna
    • Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vatten och kortare perioder med is.
    • Modellering av hur råvattenkvaliteten förändras i framtiden.
    • Mer observationer för att fånga upp klimateffekter i sjöarna.

    Till varje sjö har en referensgrupp bestående av representanter för olika intressen kring sjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inom ramen för projektet och frågeställningar som kommit upp under möten med referensgrupperna, men även befintlig litteratur har använts.

  • 16.
    Södling, Johan
    et al.
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Statistisk metodik för beräkning av extrema havsvattenstånd2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Som ett led i arbetet att förbättra metoderna för planeringsunderlag gällande extrema havsvattenstånd har SMHI gjort en inventering av statistiska metoder för extremvärdesanalys. Metoderna är vanligt förekommande när olika dimensioneringsunderlag tas fram. För att ta fram statistik med hög tillförlitlighet för händelser som har låg sannolikhet (hög återkomsttid) har dock metoderna begränsad användning.

    Tre huvudsakliga metoder har applicerats på SMHI:s havsvattenståndsdata. Den mest vanliga, Blockmaximum-metoden, används vanligtvis på årshögsta vattenstånd. POT – metoden (Peak Over Threshold), använder fler data och är inte lika vanlig. I Norge används en variant av POT – metoden, den så kallade ACER-metoden (Average Conditional Exceedance Rate). Den är mycket lämplig för att ta fram värden för lägre återkomsttider, och är förhållandevis robust när data läggs till vartefter.

    Metodernas lämplighet och känslighet utvärderades för extrema havsvattenstånd, alltså havsvattenstånd med höga återkomsttider(låg sannolikhet). Slutsatsen är att det inte går att välja en metod som överlägsen den andra, och att kunskap om den aktuella platsens oceanografiska förhållanden behövs för att utvärdera resultatens rimlighet. I alla analyser av extrema havsvattenstånd är det viktigt att beakta datakvalité och dataseriens längd. Resultat bör redovisas med konfidensintervall.

    Blockmaximum-metoden testades med olika fördelningar. Gumbel-fördelning visar sig kunna ge orimliga nivåer för vattenståndsextremer och rekommenderas därför inte. GEV (Generalized Extreme Value) och Log-normal fördelning används med fördel i kombination.POT-metoder tar till vara fler händelser än de riktigt extrema, men resultaten som ges har väldigt stora konfidensintervall som växer för låg sannolikhet. Om tröskeln sätts för låg är det inte extremvattenstånd som utvärderas.

    Som en följd av denna analys bestämdes att andra metoder behöver tas fram för att studera de högsta havsvattenstånden längs Sveriges kust. I Schöld m.fl. (2017) redovisas hur man kan gå till väga för att ta fram högsta beräknade havsvattenstånd utifrån befintliga data.

  • 17.
    Karttjänst för framtida medelvattenstånd längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Havsnivån stiger och orsaken är den globala uppvärmningen. Effekterna av uppvärmningen på havets nivå kommer främst från den termiska expansionen samt bidrag från smältande glaciärer och de stora landisarna på Grönland och Antarktis.

    Hur snabbt den globala havsnivån stiger beror på hur stora utsläppen av växthusgaser blir. Globala medelvattenstånd fram till år 2100 har framtagits inom IPCC och beskrivs utifrån klimatscenarier, som innebär olika antaganden om den framtida utvecklingen. Oavsett klimatscenario stiger havsnivån och den kommer att fortsätta stiga även efter år 2100. Störst osäkerhet råder, angående framtida havsnivåer, kring avsmältningen av de stora ismassorna på Grönland och Antarktis.

    Medelvattenståndet är den nivå som avgör var strandlinjen normalt ligger och som höga och låga vattenstånd varierar kring. Medelvattenståndet längs Sveriges kuster kommer att förändras olika mycket, främst beroende på den pågående landhöjningen. Andra regionala processer som kan påverka medelvattenståndet är dåligt kända men bedöms i nuläget vara små.

    Globala medelvattenstånd, framtagna inom IPCC AR5, i kombination med landhöjningsinformation från Lantmäteriet har använts för att göra beräkningar av framtida medelvattenstånd längs svenska kusten. Beräkningarna sträcker sig till år 2100. Medelvattenstånd vid observationsplatser längs kusten för referensperioden 1986-2005 används som utgångsvärde.

    Resultaten har publicerats i en karttjänst som visar medelvattenståndet enligt tre olika utsläppsscenarier kring år 2050 respektive år 2100. Karttjänsten ger indikationer för vilka områden som kan vara sårbara för stigande havsnivåer.

  • 18.
    Nerheim, Signild
    et al.
    SMHI, Affärsverksamhet.
    Schöld, Sofie
    SMHI, Samhälle och säkerhet.
    Persson, Gunn
    SMHI, Affärsverksamhet.
    Sjöström, Åsa
    SMHI, Samhälle och säkerhet.
    Framtida havsnivåer i Sverige2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Sveriges kustområden drabbas ibland av tillfälliga översvämningar i samband med stormar eller då kraftiga lågtryck passerar. Översvämningar kan orsaka allvarliga samhällsstörningar och vatteninträngning i byggnader kan ge upphov till stora kostnader. Den pågående globala uppvärmningen, med stigande havsnivåer som följd, aktualiserar frågan om hur vattenståndet kring svenska kusten kan förändras, idag och i framtiden. Havet stiger och det kommer att pågå under hundratals eller kanske till och med tusentals år framöver.

    SMHI startade 2015 ett projekt för att beskriva havsnivåer längs svenska kusten i dagens och framtidens klimat. Projektet har levererat:

    • Beräknade medelvattenstånd för hela Sveriges kust för år 2050 och år 2100 utifrån tre olika framtida klimatscenarier.
    • En visningstjänst för framtida medelvattenstånd.
    • En beskrivning av hur höga havsvattenstånd kan beräknas för en specifik plats.
    • Höga vattenstånd för SMHI:s mätstationer samt en visualisering av dessa.
    • En översikt över statistisk metodik.
    • En vägledning för utvärdering av lokala effekter.
    • En beskrivning av kända högvattenhändelser i olika kustområden och parametrar och processer relaterade till dessa.

    Denna rapport presenterar en översikt över resultaten som tagits fram i projektet och avslutas med en beskrivning av hur framtidens höga havsnivåer kan bedömas i planeringssyfte. SMHI har i rapporten inte tagit ställning till vilket klimatscenario eller vilken tidshorisont som är mest lämpligt att använda för samhällsplanering. Detta måste bestämmas i ett situationsspecifikt sammanhang där risk och kostnader beaktas. SMHI vill betona att även om år 2100 ofta anges som slutår för klimatscenarier, så kommer havets nivå att fortsätta att stiga längre än så.

    Rapporten summerar resultat från övriga rapporter som framtagits inom projektet. För ytterligare detaljer hänvisas till dessa (se Förord).

  • 19.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Hellström, Sverker
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Kållberg, Per
    SMHI, Forskningsavdelningen, Meteorologi.
    Lindow, Helma
    SMHI, Samhälle och säkerhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Schimanke, Semjon
    SMHI, Forskningsavdelningen, Oceanografi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Vattenståndsdynamik längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    För att skapa ett samhälle väl anpassat till dagens och framtidens havsnivåer behövs besluts- och planeringsunderlag. Skyddsåtgärder och designnivåer för kustskydd är högaktuella frågor och många aktörer är intresserade av information kring potentiella maxnivåer för vattenstånd på olika tidshorisonter. SMHI har därför analyserat de mätdataserier för havsvattenstånd som idag finns tillgängliga från stationer längs Sveriges kust. Det primära syftet var att ta fram en metod för att beräkna det högsta möjliga havsvattenståndet vid mätstationer längs Sveriges kust. Metoden beskrivs i Schöld m.fl.(2017).

    I föreliggande rapport beskrivs allmänt havsnivåer, mätdata, modeller och de resultat som erhölls från olika analyser av mätdata. Mätstationerna indelades i åtta olika kustområden inom vilka vattenståndet samvarierar. Det väder och de specifika stormbanor, som under de senaste 40 åren orsakat de högsta stormfloderna på olika platser längs den svenska kusten kartlades, och vattenståndsdynamiken vid olika mätstationer studerades.

    Kortvariga höjningar av vattenståndet undersöktes, både med avseende på kraftiga vattenståndshöjningar orsakade av passerande väderssystem och med avseende på förhöjda utgångslägen, som i sin tur kan bidra till att stormfloder blir extra höga.

    Det högsta beräknade havsvattenstånd som presenteras är de högsta möjliga stormfloder som skulle kunna inträffa baserat på empiriska analyser av mätdata vid de olika stationerna. Kända extrema händelser, som ägt rum före det att vattenståndet började registreras, ingår inte eftersom de inte har kunnat kvantifieras. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport.

    Resultaten från studien visar att vattennivåerna i Östersjön generellt blir som högst i Bottenviken och i de södra delarna. De höga vattenstånden i större delen av Östersjön är inte lika höga som på västkusten och i Öresund. I Östersjön förefaller också utgångsläget, havsnivån före stormen, utgöra en större del av den resulterande vattenståndshöjningen. Vid flera stationer i de centrala delarna av Östersjön är havsnivån före storm i stort sett hälften av det högsta beräknade havsvattenståndet. Längs västkusten är istället de nettohöjningar som orsakas av rena stormeffekter den viktigaste stormflodskomponenten. Lokala förhållanden, till exempel om stationen är belägen vid en öppen, rak kust eller inne i en vik, påverkar hur högt vattenståndet kan förväntas bli på en viss plats.

    Analyserna visar att stormfloder skulle kunna bli omkring 20-40 cm högre än hittills observerade maximala nivåer i olika kustområden. En osäkerhetsmarginal på runt +15 cm är lämplig att addera, särskilt i de områden där tidvatten förekommer.

  • 20.
    Johansson, Lasse
    et al.
    SMHI, Affärsverksamhet.
    Gyllenram, Walter
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Lokala effekter på extrema havsvattenstånd2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    När havsvattennivån ska beräknas för en viss plats behöver hänsyn tas till lokala förhållanden. Vattenståndet lokalt kan avvika från det som observeras vid en av SMHI:s eller andras mätplatser. Geografin på platsen och vågor kan leda till högre vattennivåer än de som observeras vid mätplatserna.

    Denna rapport ger en kort beskrivning av hur vattenståndet längs Sveriges kuster byggs upp. Vi ger exempel på olika mekanismer för att läsaren ska få en uppfattning om skalorna i tid och höjd. Vågfenomen lokalt kan leda till att ytterligare högre nivåer kan beröras av vatten än vad vattenståndet anger.

    En översiktlig beskrivning görs av hur vågor interagerar med stränder ochkajer. Begreppen våguppstuvning och våguppsköljning förklaras. Några exempel ges på vilken effekt bottens lutning har och hur vågor utvecklas i hamnar.

    För att beräkna återkomstvärden för vattenstånd på en lokal plats beskrivs hur man kan utgå från de mätningar som SMHI gör sedan många år. Observationer från den närmaste eller de närmaste mätplatserna kan användas för att beräkna vattenstånd med olika återkomsttider för den önskade platsen. Ett exempel på en sådan beräkning presenteras där speciellt viktiga detaljer redovisas.

  • 21.
    Viktorsson, Lena
    et al.
    SMHI, Samhälle och säkerhet.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Revidering av fysikaliska och kemiskabedömningsgrunder i kustvatten: Underlag inför uppdatering av HVMFS 2013:192018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Detta är ett underlag för revidering av bilaga 5 i HVMFS 2013:19, Bedömningsgrunder för fysikaliskkemiskakvalitetsfaktorer i kustvatten och vatten i övergångszonen. Underlaget innefattar främst enuppdatering av referensvärden för näringsämnen samt förslag på uppdatering av viss text i föreskriftengällande syrebalans och siktdjup. Den generella metoden för var och en av stödparametrarna ibedömningsgrunderna bibehålls. I rapportens sista kapitel presenteras de uppdateringar av föreskriftenHVMFS 2013:19 som rekommenderas utifrån detta uppdrag.Efter en jämförelse av tidigare framtagna referensvärden för näringsämnen och de som tagits fram iden här rapporten rekommenderas att nya referensvärden i tillrinnande sötvatten används men atttidigare referensvärden för TN och TP vid utsjösalthalt samt att klassgränser behålls. En mindrejustering av referensvärden för DIN och DIP utifrån havsmiljöförordningens G/M värden föreslåsdock. De nya referensvärdena är framtagna med modellen S-HYPE (Lindström m.fl. 2010) förtillrinnande sötvatten och utifrån utsjövärden för oorganiskt fosfor och kväve (HVMFS 2012:18) samteffektsamband i mätdata. Det förtydligas också att ett konstant referensvärde för näringsämnenanvänds vid salthalter ≤2 psu.Den S-HYPE körning som använts för referensvärden i tillrinnande sötvatten är en bakgrundskörningsom är anpassad till definitionen av bakgrundsbelastning i PLC6 (Pollution Load Compilation 6,HELCOM).Utöver uppdatering av referensvärden för näringsämnen så föreslås en förändrad sammanvägning avkväve och fosfor i bedömningsgrunden. Det innebär att de ingående parametrarna för kväve och fosforsammanvägs var för sig. Bedömningsgrunderna ger då en separat status för varje näringsämne (kväveoch fosfor) baserat på de ingående parametrarna. Detta ger både en större möjlighet till att se vilketnäringsämne som bidrar till att eventuellt sänka status och stämmer överens med hur rapporteringentill EU-kommissionen ska ske.För syre rekommenderas en uppdatering om vilka mätmetoder som får användas, så att ävenmätningar med sensorer kan användas för statusbedömning. För siktdjup var ambitionen att ta fram etthumusgränsvärde för när kvalitetsfaktorn inte ska tillämpas. En fullständig statistisk analys har intehunnits med och en tydlig rekommendation kan inte ges.Det har under arbetet med att ta fram nya referensvärden för näringsämnen enligt nuvarande metodblivit tydligt att metoden för att bedöma näringsämnen behöver en mer övergripande uppdatering. Tillexempel kan metoden för salthaltskorrektion troligen förbättras med hjälp av en analys av mätdata ikombination med kustzonsmodellen.

  • 22.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Beräkning av högsta vattenstånd längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I rapporten redovisas hur en metod framtagits för att kunna skatta de allra högsta havsvattenstånd som kan uppträda vid de mätstationer för havsvattenstånd som finns längs Sveriges kust. Metoden är generell och principerna kan därför tillämpas på mätdataserier från olika platser. För att kunna tillämpa metoden måste dock mätdataserien ha en viss minimilängd och tidsupplösning. Resultaten som tas fram är empiriska, vilket betyder att de baseras på tillgängliga mätdata.

    I analysen delades data upp i två delar; det genomsnittliga vattenståndet före en högvattenhändelse och nettohöjningen under en högvattenhändelse. Dessa delar benämns havsnivå före storm respektive nettohöjning, i enlighet med:

    stormflod = havsnivå före storm + nettohöjning

    Nivån på stormfloden är det högsta uppmätta havsvattenståndet under respektive högvattenhändelse. I analysen har även högvattenhändelser som inte förknippas med stormar inkluderats. Många av de högsta stormfloderna har inträffat när havsnivån före storm är förhöjd jämfört med medelvattenståndet, framförallt i stora delar av Östersjön. I analysen ingår samtliga högvattenhändelser från vilka det finns tillgänglig mätdata, även sådana som startat från ett lågt utgångsläge.

    I analysen indelades mätstationerna i olika kustområden och samvariationen mellan mätstationerna undersöktes. För varje enskild station, där havsvattenstånd observeras, har högsta havsnivå före storm och högsta nettohöjning framtagits. Den högsta havsnivån före storm som uppmätts inom kustområdet bedömdes gälla för alla mätstationer inom området. Det högsta beräknade havsvattenståndet definierades som kustområdets högsta havsnivå före storm plus mätstationens högsta nettohöjning.

    Tidvatteneffekten har inte beaktats särskilt, utan är i viss mån inkluderad i nettohöjningen. Denna förenkling beskrivs närmare i Schöld m fl. (2017).

    Analysen visade att:

    • samvariationen inom kustområden är mycket hög för vanligt förekommande vattenstånd.
    • högvattenhändelser förekommer oftare i vissa kustområden.
    • de högsta vattenstånden kan variera mycket, även mellan stationer inom samma kustområde.
    • havsnivån före storm är en mer betydande stormflodskomponent i Östersjön och mindre betydande i Skagerrak-Kattegatt.
    • havsnivån före storm behöver identifieras så att den inte är påverkad av själva stormhändelsen.
    • det är lämpligt att uppdatera det högsta beräknade havsvattenståndet regelbundet,särskilt efter att nya rekordhöga stormfloder inträffat.

    Vi valde att definiera havsnivån före storm som ett medelvärde över sju dygn, 48 timmar före stormflodens maximum. Metodiken avser nivåer ovanpå ett gällande medelvattenstånd. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport. Tillämpningen av metoden i ett framtida klimat beskrivs i Nerheim m fl. (2017).

  • 23.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2018Rapport (Övrigt vetenskapligt)
  • 24.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden.: Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra störstasjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren ärmycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är detVänern som har de största problemen i dagens klimat och fram till slutet av detta sekel,medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längretidsperspektiv.Klimatförändringarna medför bland annat förändrade vattennivåer, förändradevattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilketger konsekvenser för olika intressen runt sjöarna.En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte ärtydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är etthinder för att komma vidare med de problem som idag finns för Vänern och för denlångsiktiga klimatanpassningen av Mälaren, bortom detta sekel.Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring: Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vattenoch kortare perioder med is. Modellering av hur råvattenkvaliteten förändras i framtiden. Mer observationer för att fånga upp klimateffekter i sjöarna.Till varje sjö har en referensgrupp bestående av representanter för olika intressen kringsjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inomramen för projektet och frågeställningar som kommit upp under möten medreferensgrupperna, men även befintlig litteratur har använts.

  • 25.
    Eilola, Kari
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Lindqvist, Stina
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Wåhlstrom, Irene
    SMHI, Forskningsavdelningen, Oceanografi.
    Bartoli, Marco
    Klaipeda University, Lithuania.
    Burska, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Carstensen, Jacob
    Aarhus University, Denmark.
    Hellemann, Dana
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hietanen, Susanna
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hulth, Stefan
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Janas, Urszula
    Institute of Oceanography, University of Gdansk, Poland.
    Kendzierska, Halina
    Institute of Oceanography, University of Gdansk, Poland.
    Pryputniewicz-Flis, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Voss, Maren
    Leibniz Institute for Baltic Sea Research Warnemünde, Germany.
    Zilius, Mindaugas
    Klaipeda University, Lithuania.
    Linking process rates with modellingdata and ecosystem characteristics2017Rapport (Refereegranskat)
    Abstract [en]

    This report is related to the BONUS project “Nutrient Cocktails in COAstal zones of the Baltic Sea” alias COCOA. The aim of BONUS COCOA is to investigate physical, biogeochemical and biological processes in a combined and coordinated fashion to improve the understanding of the interaction of these processes on the removal of nutrients along the land-sea interface. The report is especially related to BONUS COCOA WP 6 in which the main objective is extrapolation of results from the BONUS COCOA learning sites to coastal sites around the Baltic Sea in general. Specific objectives of this deliverable (D6.4) were to connect observed process rates with modelling data and ecosystem characteristics.

    In the report we made statistical analyses of observations from BONUS COCOA study sites together with results from the Swedish Coastal zone Model (SCM). Eight structural variables (water depth, temperature, salinity, bottom water concentrations of oxygen, ammonium, nitrate and phosphate, as well as nitrogen content in sediment) were found common to both the experimentally determined and the model data sets. The observed process rate evaluated in this report was denitrification. In addition regressions were tested between observed denitrification rates and several structural variables (latitude, longitude, depth, light, temperature, salinity, grain class, porosity, loss of ignition, sediment organic carbon, total nitrogen content in the sediment,  sediment carbon/nitrogen-ratio, sediment chlorphyll-a as well as bottom water concentrations of oxygen, ammonium, nitrate, and dissolved inorganic  phosphorus and silicate) for pooled data from all learning sites.

    The statistical results showed that experimentally determined multivariate data set from the shallow, illuminated stations was mainly found to be similar to the multivariate data set produced by the SCM model. Generally, no strong correlations of simple relations between observed denitrification and available structural variables were found for data collected from all the learning sites. We found some non-significant correlation between denitrification rates and bottom water dissolved inorganic phosphorous and dissolved silica but the reason behind the correlations is not clear.

    We also developed and evaluated a theory to relate process rates to monitoring data and nutrient retention. The theoretical analysis included nutrient retention due to denitrification as well as burial of phosphorus and nitrogen. The theory of nutrient retention showed good correlations with model results. It was found that area-specific nitrogen and phosphorus retention capacity in a sub-basin depend much on mean water depth, water residence time, basin area and the mean nutrient concentrations in the active sediment layer and in the water column.

  • 26.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and  Development of an oxygen consumption  indicator2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten innehåller två delar vilka båda är fristående rapporter och ett bidrag till HELCOM-projektet EUTRO-OPER. Uppdraget har finansierats och beställts av Havs- och Vattenmyndigheten (HaV), 2014-2015.

    • Bedömning av övergödning i kustvatten med HEAT 1.0 (Vattendirektivets metodik) versus HEAT 3.0 (Havsmiljödirektivets metodik)

    Status för övergödning bedöms nationellt i kustnära områden i Vattendirektivet (VD) och i öppet hav inom Havsmiljödirektivet (HMD). Båda direktiven tar hänsyn till övergödning men med olika tillvägagångssätt och det finns därför ett behov av harmonisering i bedömningsprocessen. Det Excelbaserade verktyget HEAT (HELCOM Eutrophication Assessment Tool) har använts i tidigare bedömningar i HELCOM-regionen. Det finns två versioner; HEAT 1.0 och HEAT 3.0, den första är baserat på VD metodik och den andra är baserad på HMD metodik. Den största skillnaden mellan HEAT 1.0 och HEAT 3.0 är hur indikatorerna är grupperade. Här bedömer vi status för övergödning i kustvatten med HEAT och jämför resultaten med den nationella bedömningen inom VD. Detta test inkluderar data för 33 vattenförekomster i fem länder; Estland, Finland, Lettland, Polen och Sverige. Information om referensvärden, acceptabel avvikelse, status och klassgränser för alla indikatorer som används inom VD för att rapportera ekologisk status (biologisk och fysisk-kemisk) har tillhandahållits för varje testområde. Informationen har lagts in i HEAT 1.0 och HEAT 3.0 och jämförts med den nationella bedömningen inom VD. Båda HEAT-verktygen genererade lägre status i mer än 50 % av fallen. För en del fall ändrades status till sub-GES från GES när HEAT användes. Klassgränsen för god/måttlig status är densamma i HEAT och VD medan de lägre klassgränserna generellt är striktare i HEAT vilket förklarar den lägre statusen. I nationella bedömningar inom VD används expertbedömning i de fall där in situ data är bristfällig, saknas eller har hög osäkerhet. Statusen i HEAT ges av en-ut-alla-ut principen men det är ändå möjligt att inkludera expertbedömning genom viktningsprocessen.

    • Utveckling av en syreindikator

    Det undersöktes om syrekonsumption kan användas som en syreindikator för Östersjön. Metoden är baserad på idén att beräkna syrekonsumptionen i ett stabilt lager under den produktiva zonen sommartid och relatera den till närsaltskoncentrationer. Med mer närsalter tillgängliga ökar den biologiska produktionen. Genom att uppskatta hur mycket syre som behövs för att bryta ned det biologiska materialet borde det vara möjligt att koppla syrekonsumption till övergödning. Syrekonsumptionen beräknades för BY15-Gotlandsdjupet i östra Gotlandsbassängen. Vi identifierade ett stabilt lager mellan 30 och 50 meter och en stor förändring i syre och närsalter från juni till augusti. Syrekonsumptionen hade stora variationer mellan år och det fanns ingen signifikant korrelation till vintermedel av närsalter. Det var inte möjligt att beräkna diffusionen på grund av för glesa mätningar kring skiktningen, detta begränsar metoden. Det är däremot möjligt att förbättra uppskattningen av diffusionen med en modell. Djupet av det stabila lagret varierar mellan områden och även mellan år vilket kräver en del handpåläggning för metoden. Vi insåg att metoden har för många begränsningar för att vara en funktionell indikator. En funktionell indikator ska inte vara beroende av krävande modellering eller för mycket handpåläggning. Vi undersökte också om en möjlig kandidat till en lite enklare syrekonsumptionindikator skulle kunna vara att beräkna syremättnaden på en specifik nivå. Om vi antar att temperaturen inte har ändrats så mycket sedan skiktningen etablerades kan vi förvänta oss att förändringen i syremättnad i augusti beror på biologisk syrekonsumption under sen vår och sommar. Korrelationen med vinternärsalter förbättrades något i detta fall. 

  • 27.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and Development of an oxygen consumption indicator2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten innehåller två delar vilka båda är fristående rapporter och ett bidrag till HELCOM-projektet EUTRO-OPER. Uppdraget har finansierats och beställts av Havs- och Vattenmyndigheten (HaV), 2014-2015.

    • Bedömning av övergödning i kustvatten med HEAT 1.0 (Vattendirektivets metodik) versus HEAT 3.0 (Havsmiljödirektivets metodik)

    Status för övergödning bedöms nationellt i kustnära områden in Vattendirektivet (VD) och i öppet hav inom Havsmiljödirektivet (HMD). Båda direktiven tar hänsyn till övergödning men med olika tillvägagångssätt och det finns därför ett behov av harmonisering i bedömningsprocessen. Det Excelbaserade verktyget HEAT (HELCOM Eutrophication Assessment Tool) har använts i tidigare bedömningar i HELCOM-regionen. Det finns två versioner; HEAT 1.0 och HEAT 3.0, den första är baserat på VD metodik och den andra är baserad på HMD metodik. Den största skillnaden mellan HEAT 1.0 och HEAT 3.0 är hur indikatorerna är grupperade. Här bedömer vi status för övergödning i kustvatten med HEAT och jämför resultaten med den nationella bedömningen inom VD. Detta test inkluderar data för 33 vattenförekomster i fem länder; Estland, Finland, Lettland, Polen och Sverige. Information om referensvärden, acceptabel avvikelse, status och klassgränser för alla indikatorer som används inom VD för att rapportera ekologisk status (biologisk och fysisk-kemisk) har tillhandahållits för varje testområde. Informationen har lagts in i HEAT 1.0 och HEAT 3.0 och jämförts med den nationella bedömningen inom VD. Båda HEAT-verktygen genererade lägre status i mer än 50 % av fallen. För en del fall ändrades status till sub-GES från GES när HEAT användes. Klassgränsen för god/måttlig status är densamma i HEAT och VD medan de lägre klassgränserna generellt är striktare i HEAT vilket förklarar den lägre statusen. I nationella bedömningar inom VD används expertbedömning i de fall där in situ data är bristfällig, saknas eller har hög osäkerhet. Statusen i HEAT ges av en-ut-alla-ut principen men det är ändå möjligt att inkludera expertbedömning genom viktningsprocessen.

    • Utveckling av en syreindikator

    Det undersöktes om syrekonsumption kan användas som en syreindikator för Östersjön. Metoden är baserad på idén att beräkna syrekonsumptionen i ett stabilt lager under den produktiva zonen sommartid och relatera den till närsaltskoncentrationer. Med mer närsalter tillgängliga ökar den biologiska produktionen. Genom att uppskatta hur mycket syre som behövs för att bryta ned det biologiska materialet borde det vara möjligt att koppla syrekonsumption till övergödning.

    Syrekonsumptionen beräknades för BY15-Gotlandsdjupet i östra Gotlandsbassängen. Vi identifierade ett stabilt lager mellan 30 och 50 meter och en stor förändring i syre och närsalter från juni till augusti. Syrekonsumptionen hade stora variationer mellan år och det fanns ingen signifikant korrelation till vintermedel av närsalter. Det var inte möjligt att beräkna diffusionen på grund av för glesa mätningar kring skiktningen, detta begränsar metoden. Det är däremot möjligt att förbättra uppskattningen av diffusionen med en modell. Djupet av det stabila lagret varierar mellan områden och även mellan år vilket kräver en del handpåläggning för metoden. Vi insåg att metoden har för många begränsningar för att vara en funktionell indikator. En funktionell indikator ska inte vara beroende av krävande modellering eller för mycket handpåläggning. Vi undersökte också om en möjlig kandidat till en lite enklare syrekonsumptionindikator skulle kunna vara att beräkna syremättnaden på en specifik nivå. Om vi antar att temperaturen inte har ändrats så mycket sedan skiktningen etablerades kan vi förvänta oss att förändringen i syremättnad i augusti beror på biologisk syrekonsumption under sen vår och sommar. Korrelationen med vinternärsalter förbättrades något i detta fall. 

  • 28.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Fölster, Jens
    Drakare, Stina
    Sonesten, Lars
    Förslag till plan för revidering av fysikalisk-kemiska bedömningsgrunder för ekologisk status i sjöar, vattendrag och kustvatten Del A: SJÖAR OCH VATTENDRAG (SLU) Del B: KUSTVATTEN (SMHI)2017Rapport (Övrigt vetenskapligt)
  • 29.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Axe, Philip
    SMHI, Forskningsavdelningen, Oceanografi.
    Johansson, Johannes
    SMHI, Samhälle och säkerhet.
    Linders, Johanna
    SMHI, Samhälle och säkerhet.
    Nexelius, Nils
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    Swedish National Report on Eutrophication Status in the Skagerrak, Kattegat and the Sound - OSPAR ASSESSMENT 20162017Rapport (Övrigt vetenskapligt)
    Abstract [en]

    The Swedish OSPAR waters were assessed by applying the OSPAR Common Procedure for the time period 2006 – 2014. The Swedish parts of Skagerrak, Kattegat and the Sound constitute the outer part of the transition zone between the estuarine Baltic Sea and the oceanic North Sea and were investigated for nutrients, chlorophyll-a,oxygen, macrophytes, phytoplankton and zoobenthos. The conclusion from the overall assessment of the Swedish OSPAR waters was that only Skagerrak open sea could be classified as a Non-Problem Area and all other assessment units were classified as Problem Areas.  Atmospheric input of nitrogen significantly decreased in both Skagerrak and Kattegat and the land based input of total nutrients also decreased in Skagerrak, Kattegat as well as the Sound. However, the short-term trend of nitrogen input to the Sound was positive. Skagerrak is governed by trans-boundary transports from the North Sea of mainly nitrogen but also phosphorus. Kattegat receives trans-boundary nutrients from both the Baltic Sea through the Sound and from Skagerrak and transports nutrients towards the coast and the western part of the basin.  Overall, concentrations of DIN, DIP, TN and chlorophyll-a decreased in most areas, however, no significant trends were found for DIP. Increasing concentrations were found in silicate, POC and TP. The Secchi depth increased in most areas. Oxygen deficiency was mainly a problem in the fjords and the Kattegat open sea.  In Skagerrak coastal waters winter nutrients were only elevated in the fjords. Concentrations of DIN generally decreased significantly and there were tendencies of decreasing DIP. This pattern was also supported by the total nitrogen while total phosphorus increased. Secchi depth was improving and there was a significant positive trend of increasing depths. However, zoobenthos were still in bad condition and phytoplankton indicator species were often elevated. Chlorophyll-a concentrations were generally decreasing but still elevated in the inner coastal waters. There were also problems with algal toxins such as DST (Diarrhetic Shellfish Toxin) and PST (Paralystic Shellfish Toxin) infections in the area. According to the OSPAR classification scheme, a unit with no evident increased nutrient enrichment can be classified as a Problem Area but the cause might be due to trans-boundary transport from adjacent areas. In the open area of Kattegat there were still problems with oxygen deficiency, especially in the southern parts, even though the trend was significantly positive for the assessment period 2006 – 2014. Concentrations of chlorophyll-a and DIN decreased significantly, however, DIN levels were still generally elevated, especially in the southern parts of Kattegat while DIP was closer to the assessment level. In Kattegat coastal waters winter nutrients were elevated in all assessment units, except from the inner coastal waters, even though there was a general pattern of decreasing going trends. Chlorophyll-a was mainly elevated in the Sound and the estuaries. Secchi depth is generally improving and a significant increase was seen in the Sound. Also in Kattegat, zoobenthos were in bad condition and phytoplankton indicator species were often elevated. 

  • 30.
    Andersson, Pia
    et al.
    SMHI, Samhälle och säkerhet.
    Hansson, Martin
    SMHI, Samhälle och säkerhet.
    Bjurström, Joel
    Simonsson, Daniel
    Naturtypsbestämning av miljöövervakningsstationer SMHI pelagial miljöövervakning2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Provtagningsstationerna i den nationella miljöövervakningen i havsmiljö är inte naturtypsbestämda. Detta innebär att insamlad miljöövervakningsdata inte kan användas fullt ut till bedömningar för artikel 17, art- och habitatdirektivet, samt för havsmiljödirektivet.  HaV har finansierat och uppdragit åt SMHI att undersöka möjligheterna att på ett enkelt sätt naturtypsklassa de månatliga miljöövervakningsstationerna som SMHI provtar. Uppdraget avsåg att testa utrustning och med hjälp av dropvideo undersöka om det är möjligt att, och i så fall, naturtypsbestämma stationer i utsjön under decemberexpeditionen 2016.  SMHI har konstruerat en rigg och utfört provtagning på 11 av 25 miljöövervakningsstationer. Belysningsproblematik och väder reducerade antalet provtagna stationer. SMHI anser att riggen, med justerad ljuskälla, är ett bra verktyg för visuell registrering av naturtyp på miljöövervakningsstationerna i utsjön.  Dock föreslås ett antal justeringar av riggen för att öka kvalitén på bildmaterialet samt att öka möjligheten att utföra ytterligare bedömningar av bildmaterialet.  Merparten av de undersökta bottnarna visar på väldigt finkornigt materiel, likt silt/lera. Ett fåtal arter har registrerats och ingen större mängd växtlighet. Merparten av de undersökta stationerna uppfyllde inte kriteriet för någon av habitatdirektivets naturtyper. På två stationer har naturtyp registreras som 1160 Vikar och sund, innehållandes1110 Sandbankar. För HUB Underwater biotopes har AB.H3O Baltic aphotic muddy sediment characterized by infaunal echinoderms registrerats på stationen P2 och AB.M4U Baltic aphotic mixed substrate characterized by no macrocommunity på stationerna BY5 och BY4.  SMHI rekommenderar en genomgång av det insamlade materialet med ArtDatabanken och/eller ytterligare expert för att säkerställa bedömning, utföra vissa rekommendationer samt säkerställa material som ska rapporteras till datavärd.SMHI rekommenderar ytterligare visuell provtagning på resterande stationer, samt kompletterande provtagning på stationer där kvalité på bild eller ljus varit bristfällig, eller där ArtDatabanken eller möjlig ytterligare expert rekommenderar ytterligare provtagning. Ytterligare expert kan komma att rekommendera hugg som kompletterande provtagning till den visuella metoden.En visuell undersökning på samtliga 25 stationer, med en landning per station, uppskattas förlänga en expedition med ca 11,5-13,5 timmar. 

  • 31.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Summary of the Swedish National Marine Monitoring 2016 - Hydrography, nutrients and phytoplankton2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Resultat från Sveriges nationella samlade nationella marina övervakning i den fria vattenmassan under året 2016 presenteras. De nationella utförarna är Sveriges metrorologiska och hydrologiska institut (SMHI), Stockholms Universitet (SU) och Umeå marina forskningscentrum (UMF). De parametrar som presenteras i rapporten är salthalt, temperatur, syre, löst oorganiskt fosfor, totalfosfor, löst oorganiskt kväve, totalkväve, löst kisel, klorofyll och växtplankton. Även siktdjup, djurplankton, humus, primär produktion, pH och alkalinitet provtas men de presenteras inte. Säsongsfigurer tillsammans med statistik presenteras för ytvatten i Bilaga I. Tidsserier för ytvatten (0-10 m) och bottenvatten presenteras i Bilaga II. Mängden närsalter i Östersjöns delbassänger under vintern presenteras i bilaga III.Speciella händelser 2016

    • Flertalet högtryckspassager orsakade en ovanligt varm septembermånad, vilket gav yttemperaturer mer än en standard avvikelse över det normala vid nästa alla stationer i Skagerrak, Kattegatt och Östersjön.
    • I Kattegatts bottenvatten var det mycket låga syrgashalter under hösten men förhållandena återgick till det normala under vintern. Detta syns framförallt i säsongsfigurerna för Anholt E och Fladen.
    • Syresituationen i Östra Gotlandsbassängen har förbättrats något och anledningen är att antalet inflöden har blivit fler sedan det senaste stora inflödet som skedde i december 2014. Inflödet på 30 km3 i början av året kunde senare under juni spåras i bottenvattnet i Östra Gotlandsbassängen. 
    • Nivåerna av kisel i Östersjön har under de senaste åren varit över det normala och så även detta år men främst i de centrala och norra delarna av Egentliga Östersjön.
    • I juli noterades förhållandevis stora mängder av dinoflagellaten Dinophysis acuminata. Detta orsakade förhöjda halter av Dinophysis-toxiner i blåmusslor vilket i sin tur ledde till att Livsmedelsverket förbjöd musselskörd i vissa områden längs Bohuskusten.
    • Ovanligt lång blomning av cyanobakterier i Östersjön.
  • 32.
    Wåhlström, Irene
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eilola, Kari
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Evaluation of open sea boundary conditions for the coastal zone. A model study in the northern part of the Baltic Proper.2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Miljötillståndet i Sveriges kustvatten är starkt kopplat till tillståndet i det öppna havet på grund av det stora vattenutbytet mellan dessa. Det är därför viktigt att modeller utvecklade för kustzonens vatten har drivning från utsjön av god kvalitet med bra täckning i tid och rum samt med information om de variabler som krävs.

    För att beräkna vattenkvalitén i kustnära vatten har SMHI utvecklat en modell kallad kustzonsmodellen (SCM). Den drivs för närvarande från öppna havet av resultatfiler från en en-dimensionell modell som med hjälp av observationer har korrigerat och förbättrat modellresultaten. Tyvärr är dessa observationer undermåliga i tid och rum, och saknar nödvändiga variabler för att få bra drivning av SCM modellen. Dessa mätstationer ligger också längre ut i öppna havet och kan därför underskatta variabiliteten närmare kusten för de olika parametrarna. Dessa problem löses delvis med den en-dimensionella modellen som beräknar alla de variabler som är nödvändiga i SCM. Dock är dessa resultat inte användbara om man vill undersöka en historisk period eller framtida klimatförändringar i kustzonen. På grund av dessa tillkortakommanden undersöker vi i denna studie om det är möjligt att istället ersätta dagens drivning från öppna havet med resultat från en tre-dimensionell, kopplad fysisk och biogeokemisk modell för Östersjön som drivning för SCM, framförallt för att undersöka de två ovan nämnda perioder.

    I denna studie har sju känslighetsexperiment utförts i en pilotstudie för Norra Östersjön, inklusive Stockholms skärgård. De sju känslighetsexperimenten utfördes för att utvärdera olika metoder att extrahera resultat-filer från den tre-dimensionella modellen RCO-SCOBI med avsikt att användas som drivning för SCM. RCO-SCOBI är en modell för Östersjön med hög horisontell och vertikal upplösning av de variabler som krävs. Resultaten för både de fysiska och biogeokemiska processerna från de olika testen undersöktes och utvärderades mot observationer i kustzonen med hjälp av en statistisk metod.

    Slutsaten från dessa test är att resultatfiler från RCO-SCOBI är tillämpbara som utsjödrivning för SCM. Den bästa metoden är att extrahera en djupprofil per variabel för varje ytterbassäng i SCM i en punkt 10 nautiska mil österut och 10 nautiska mil söderut i egentliga Östersjön eller norrut i Bottenhavet för varje ytterbassäng i SCM.

  • 33.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Denna rapport presenterar hur vattentemperatur och is beräknas förändras i Mälaren tillmitten av seklet och fram till 2100 på grund av den globala uppvärmningen.Beräkningarna är gjorda med en sjömodell där Mälaren är uppdelad i två bassänger. Dekallas västra Mälaren och östra Mälaren.De tydligaste förändringarna i Mälaren i ett framtida klimat beräknas bli högrevattentemperaturer både på ytan och på botten samt kortare period med is. Iberäkningarna har två framtidsscenarier använts, vilka baseras på mängden växthusgaser iatmosfären. I det högre scenariot, vilket motsvarar fortsatta utsläpp med dagensutsläppsnivåer, ökar vattentemperaturen mer jämfört med scenariot där utsläppen avväxthusgaser är begränsade.Sammanfattning av resultaten för klimatscenarierna: Den årliga perioden som Mälaren är täckt med is beräknas minska med enmånad till två månader mot slutet av seklet. Ytvattnets medeltemperatur beräknas öka 1,5 till 2,5 grader för bådabassängerna. Förändringen är ungefär lika stor under hela året. Bottenvattnets medeltemperatur väntas öka mellan 1 till 2 grader i den grundarevästra bassängen och 0,5 till 1,5 grader i den djupare östra bassängen.Förändringen är ungefär lika stor under hela året. Maxtemperaturen ökar något mer än medeltemperaturen för både ytvatten ochbottenvatten. Den period som ytvattnets dygnsmedeltemperatur är över 20 grader, ökar medcirka en månad upp till en och en halv månad.Medeltemperaturen och maxtemperaturen för dagens klimat är beräknad utifråntidsperioden 1997-2015 och utifrån 2032-2050 och 2080-2098 för ett framtida klimat.Maxtemperaturen är det högsta värdet som beräknas uppnås under perioden.

  • 34.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Harbman, Ulrika
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vänern. Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vänern fram till 2100 på grund av den globala uppvärmningen. De tydligaste förändringarna i Vänern och Göta älv i ett framtida klimat beräknas bli att:  Det blir vanligare med låga nivåer i Vänern.  Det blir vanligare med höga nivåer i Vänern.  Det blir vanligare med låga tappningar i Göta älv.  Det blir vanligare med höga tappningar i Göta älv.  Det blir högre vattentemperaturer.  Det blir kortare perioder med is. I denna rapport redovisas nya beräkningar för Vänerns nivåer som ersätter de tidigare beräkningarna från 2010 (Bergström m.fl. 2010).

  • 35.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vättern Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vättern fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Vättern i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • Det blir mindre vanligt med höga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta vattennivå) väntas bli oförändrade.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is.

    I ett varmare klimat beräknas avdunstningen öka, både från växtligheten i Vätterns tillrinningssområde och direkt från sjöns yta. Det gör att vattennivån i Vättern väntas ligga på en lägre nivå i framtiden. Enligt beräkningarna väntas medelvattennivån i Vättern minska med ca en till två decimeter till slutet av seklet, med ungefär lika stor minskning under alla årstider.Antal dagar per år med nivåer under sänkningsgränsen 88,3 m väntas öka från dagens ca 1,5 månad till ca 3 månader i mitten av seklet och 4-6 månader i slutet av seklet. De allra högsta nivåerna, beräknad högsta vattennivå, beräknas vara oförändrade i framtiden.Vattentemperaturen i Vätterns ytvatten väntas öka med ca en grad till mitten av seklet och ca 1,5 till 3 grader till slutet av seklet. Bottenvattnets temperatur väntas inte förändras till mitten av seklet men öka med upp till en grad i slutet av seklet.Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka en vecka per år till cirka två veckor i mitten av seklet och upp till 6 veckor i slutet av seklet. Antalet år då Vättern är islagd beräknas minska kraftigt till slutet av seklet.

  • 36.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Hjälmaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Hjälmaren fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Hjälmaren i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta nivå) väntas öka något.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is

    Vattennivån i Hjälmaren väntas förändras måttligt i framtida klimat. Den tydligaste förändringen är att det vänas bli vanligare med låga nivåer, främst under sommar och höst. Detta är en följd av att avdunstningen, både från växtligheten i Hjälmarens avrinningsområde och direkt från sjön, beräknas öka i framtiden. I dagens klimat är vattennivån lägre än 21, 6 m (vilket motsvarar Hjälmarens sänkningsgräns) under i genomsnitt en månad per år. I framtiden väntas nivån vara lägre än 21,6 m under ca 3,5 månader.

    För de allra högsta nivåerna (beräknad högsta vattennivå) syns en ökning för det kraftigaste utsläppsscenariot (RCP8.5) medan förändringarna är små för scenariot med begränsade utsläpp av växthusgaser (RCP4.5).Vattentemperaturen i Hjälmaren väntas öka med cirka en halv grad till mitten av seklet och mellan 1 och 2,5 grader till slutet av seklet. Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka sju veckor per år till cirka 9 veckor i mitten av seklet och upp till 12 veckor i slutet av seklet. I dagens klimat är Hjälmaren islagd varje vinter. I framtida klimat väntas isläggningen utebli vissa vintrar.

  • 37.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Nylén, Linda
    SMHI, Affärsverksamhet.
    Berggreen-Clausen, Steve
    SMHI, Affärsverksamhet.
    Berg, Peter
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Rayner, David
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Från utsläppsscenarier till lokal nederbörd och översvämningsrisker2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Inom det av MSB finansierade projektet ”Nederbörd och översvämningar i ramtidens Sverige - ett system till stöd för klimatanpassning” har SMHI ansvarat för hydrologisk och hydraulisk modellering samt framtagande av tidsserier med lokalt klimat för framtida förhållanden. Två metoder att bearbeta klimatdata har använts; SMHI:s Distributionsbaserad skalering (DBS) och en statistisk metod utarbetad vid Göteborgs universitet.

  • 38.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2016 - Extent of Anoxia and Hypoxia, 1960-20162016Rapport (Övrigt vetenskapligt)
  • 39.
    Höglund, Anders
    SMHI, Forskningsavdelningen, Oceanografi.
    Invasive species in the Baltic Sea A model study of plankton transport2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I den här rapporten modelleras ensembler av utsläpp av passiva partiklar från lokaler

    nära några utvalda hamnar runt Östersjön och Kattegatt. Partiklarna transporteras

    av strömmen. Kartor över partikeldensitet efter 2, 4, 8, 16, 32 och 52 veckor presenteras.

    Resultaten visar att många bassänger är tillräckligt smala för att partiklar ska

    transporteras från ena sidan till den andra på mindre än två veckor, exempelvis

    Kattegatt, Finska viken och Kvarken. Resultaten uppvisar också en asymmetri i

    transporten mellan olika lokaler, vilket innebär att partiklar utsläppta vid en lokal

    kräver betydligt mer tid att nå en viss annan lokal, om den nås alls, än vad partiklar

    som går i motsatt riktning kräver. Några möjliga barriärer för transport identifieras

    och diskuteras.

  • 40.
    Andersson, Helén
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eriksson Bram, Lena
    SMHI, Samhälle och säkerhet.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Lindström, Göran
    SMHI, Forskningsavdelningen, Hydrologi.
    Löptien, Ulrike
    SMHI, Forskningsavdelningen, Oceanografi.
    Strömqvist, Johan
    SMHI, Forskningsavdelningen, Hydrologi.
    Översikt av beräkningsmodeller för bedömning av fiskodlingars näringsämnesbelastning på sjöar, vattendrag, magasin och kustvatten2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten är en kunskapssammanställning som utförts av SMHI på uppdrag av Havs- och Vattenmyndigheten. Den utgör inte något ställningstagande från Havs- och vattenmyndighetens sida. Rapporten försöker att sammanfatta den problematik som associeras med näringsämnesbelastningar från fiskodlingar i öppna kassar, vilka typer av beräkningar som kan behöva göras för att få en uppfattning om hur dessa kan påverka miljön samt några olika typer av modeller för detta ändamål.

    Fisk-, alg- och skaldjursodling är en växande industri runt om i världen som kan ge såväl näringsrik och hälsosam mat som arbetstillfällen. En nackdel med framförallt fiskodling i öppna kassar är att den kan innebära en påfrestning för vattenmiljön. De näringsämnen som ofta släpps ut från odlingen kan bidra till den övergödningsproblematik som redan finns i många sjöar och havsområden. Det är därför av största vikt att få en god uppskattning av den förväntade storleken på utsläppen förknippade med en öppen odling samt hur de kan tänkas förändra vattenkvaliteten på odlingsplatsen och dess närhet. Beräkningsmodeller kan vara till god hjälp vid bedömningen.

    Fiskar utsöndrar lösta näringsämnen och från odlingskassarna faller det också ut partikulärt organiskt material i form av fekalier och oätet foder. Storleken på näringsämneskällorna behöver beräknas och det finns modeller av olika komplexitet för att uppskatta detta. Storleken på det partikulära avfallet är viktigt dels för att det bidrarmed näringsämnen till vattnet och dels för att det kan ge upphov till ansamlingar av organiskt material på bottnen. När det organiska materialet bryts ner förbrukas syre och om ansamlingarna blir omfattande finns en risk för att det uppstår syrebrist vid bottnen. Om svavelväte bildas kan det orsaka skador på såväl den odlade fisken som det lokala ekosystemet. Odlingen kan också bidra till en försämrad vattenkvalitet i sin omgivning genom att tillgången av lösta näringsämnen blir större och därmed ge en ökad algproduktion. Den ökade algproduktionen skall i sin tur brytas ner och kan i förlängningen bidra till syrebristproblematiken.

    Det finns ett antal modeller som är specifikt utvecklade för fiskodlingar i öppna kassar och de tar i olika hög grad upp den beskrivna problematiken. Rapporten innehåller detaljerade genomgångar av några av modeller för att visa på styrkor och svagheter kring olika angreppsätt. Den innehåller också sammanfattningar av några vanligt förekommande modeller som använts internationellt vid bedömning av fiskodlingars miljöpåverkan. För att minska den negativa påverkan på vattenmiljön från har det också utvecklats recirkulerande system för odling. Rapporten tar inte upp belastning från den typen av fiskodlingar. Om utsläppen från ett sådant system är känt kan dock vattenkvalitetsmodeller användas för att se effekten av utsläpp från en punktkälla.

    Rapporten sammanfattar ett antal vattenkvalitetsmodeller för sjöar, vattendrag, kust och hav. En vattenkvalitetsmodell behöver inte nödvändigtvis vara utvecklad för att beskriva konsekvenser av fiskodlingar men bör kunna hantera frågeställningar som uppkommer vid bedömningar av övergödningsrisk vid utsläpp från en punktkälla. Den behöver därför kunna simulera parametrar såsom förändringen av näringsämneskoncentrationer, primärproduktion, siktdjup och syrgashalter på olika nivåer i vattenmassan. Modeller för den här typen av uppskattningar finns också i olika komplexitetsgrad och för olika skalor i tid och rum.

    Vid modellering är en god tillgång till observationer en förutsättning för pålitliga modellresultat och behövs såväl för att driva och kalibrera modellen som för validering av modellresultaten. Det är viktigt att tillgängliga data håller god kvalitet. En noggrann analys och beskrivning av den tillgängliga databasen hjälper därmed till att bedöma tillförlitligheten av modellsimuleringarna.

  • 41.
    Andreasson, Arnold
    et al.
    Arnold Andreasson Konsult AB.
    Strömberg, Patrik
    SMHI, Samhälle och säkerhet.
    Prager, Maria
    SMHI, Samhälle och säkerhet.
    Nexelius, Nils
    SMHI, Samhälle och säkerhet.
    Automatisering av nationellt dataflöde till ICES genom skördning - en förstudie2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    SMHI är, på uppdrag av Havs- och vattenmyndigheten (HaV), datavärd för svenska marina miljöövervakningsdata. En central del i uppdraget är att årligen rapportera nationellt insamlad data till nternationella Havsforskningsrådet, ICES.

    För biologiska data sker en årlig rapportering av data levererade från föregående års övervakning. Leveranserna sker på ett format definierat av ICES. Leveransernas innehåll valideras av SMHI mot ICES valideringstjänst DATSU via uppladdning till en webbsida. När samtliga fel är rättade skickas leveranserna till ICES via e-post.

    SMHI har fått ett uppdrag från HaV att utreda om det finns en möjlighet att låta ICES skörda data som ersättning för den nuvarande hanteringen med manuella leveranser. ICES har också ett intresse av att utreda om skördning av data är en lämplig metod för framtida inhämtande av data. ICES vill även testa möjligheterna att byta leveransformat till ett nytt XML-baserat format.

    SMHI föreslår en lösning där SMHI:s tjänst för maskin-maskin-kommunikation, SHARKdata, används. SHARKdata kommer att utökas för att kunna generera exportpaket i enlighet med ICES nya XML-baserade format. ICES har även kompletterat sin valideringstjänst DATSU med ett gränssnitt för maskin-maskinkommunikation så att man med automatik kan anropa DATSU och validera exportpaket. En prototyp har utvecklats för att visa hur SHARKdata kan användas för denna typ av hantering med skördning. I prototypen ingår även konvertering till en inledande testversion av XML-formatet för datatypen Zoobenthos.

    Det fortsatta projektet efter denna förstudie planeras som ett samarbete mellan SMHI och ICES. SMHI utvecklar fortlöpande SHARKdata i takt med att ICES släpper specifikationer på format för nya datatyper, parallellt med att data rapporteras på nuvarande sätt. Detta arbete beräknas pågå under 2016 och 2017, med varierande intensitet. Efter denna test- och utvecklingsperiod antas ICES släppa en ny version av sitt rapporteringformat och då kan SMHI gå över till det nya rapporteringssättet.

  • 42.
    Kuznetsov, Ivan
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eilola, Kari
    SMHI, Forskningsavdelningen, Oceanografi.
    Dieterich, Christian
    SMHI, Forskningsavdelningen, Oceanografi.
    Hordoir, Robinson
    SMHI, Forskningsavdelningen, Oceanografi.
    Axell, Lars
    SMHI, Forskningsavdelningen, Oceanografi.
    Höglund, Anders
    SMHI, Forskningsavdelningen, Oceanografi.
    Schimanke, Semjon
    SMHI, Forskningsavdelningen, Oceanografi.
    Model study on the variability of ecosystem parameters in the Skagerrak-Kattegat area, effect of load reduction in the North Sea and possible effect of BSAP on Skagerrak-Kattegat area2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den nyligen utvecklade ekosystemmodellen NEMO-Nordic-SCOBI användes för att studera variabiliteten av några indikatorer för ekosystemet i Skagerrak- kattegatt området. Även två känslighetsstudier gjordes för att undersöka möjliga effekter av Baltic Sea Action Plan (BSAP) och en reduktion scenario av närsaltstillförsel på Skagerrak-Kattegatt området. Den utförda studien kan användas som underlag och stöd vid tolkningen av observationsdata inför utvärderingen ”Intermediate Assessments Eutrophication status assessment”. Jämförelsen mellan modelldata och observationer indikerar att modellens resultat är acceptabla. Modellerade ytvärden av salthalt, temperatur och löst fosfat (DIP) visar god överenskommelse med observerade värden. Samtidigt har modellresultaten avvikelser i vissa delområden vad gäller löst oorganiskt kväve (DIN) och löst kisel under vitertid. Dock visar modellen i sitt nuvarande tillstånd tillräckligt goda resultat för den aktuella studien. Resultaten från de två känslighetsstudierna visar en minskning av näringskoncentrationer i ytan under vintern i båda havsområdena. I Skagerrak är minskningen orsakad av reducerad närsaltstillförsel i Nordsjön. I Kattegatt minskar lösta fosfatet på grund av genomförandet av BSAP. Ingen av scenarierna visade någon signifikant påverkan på syre vid havsbotten eller på ytkoncentratiner av Chl-a.

  • 43.
    Johansson, Johannes
    et al.
    SMHI, Samhälle och säkerhet.
    Hansson, Martin
    SMHI, Samhälle och säkerhet.
    Slutrapport 2015 för uppdraget ”Databaslagring av historiska fys/kemdata från Stockholm Vatten”: Datavärdskapet Oceanografi och Marinbiologi2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    SMHI är datavärd för marinbiologiska och oceanografiska data på uppdrag av Havs- och vattenmyndigheten. I detta uppdrag från Havs- och vattenmyndigheten som är kopplat till datavärdskapet har datavärden genomfört databasläggning av fysikaliska och kemiska data från Stockholm Vatten AB. Arbetet har omfattat två stora dataset som täcker två perioder; 1968-1981 och 1982-2012.

  • 44.
    Josefsson, Weine
    et al.
    SMHI, Samhälle och säkerhet.
    Ottosson Löfvenius, Mikaell
    Perrnilla, Löfvenius
    Measurements of total ozone 2012-20152016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Rapporten sammanfattar kvalitetskontrollen, kvalitetssäkringen och mätningarna av totalozon

    vid Norrköping och Vindeln under perioden 2012-2015. Händelser som signifikant påverkat

    mätningarna är dokumenterade.

    Arbetet har finansierats av Naturvårdsverkets Miljöövervakning (programområdet Luft,

    delprogrammet ozonskiktets tjocklek) och denna period avser Avtal Nr. 211 1002 och 211-

    14-002 med ärendenummer NV-11173-11 och NV-08341-13. Motsvaras vid SMHI av

    följande diarienummer 2014/492/10.3 samt 2012/1108/10.3.

  • 45.
    Engardt, Magnuz
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord, Helene
    SMHI, Affärsverksamhet.
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    PODY-beräkningar med MATCH Sverigesystemet2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Vi har utvecklat ett programpaket som möjliggör PODY beräkningar i MATCH Sverigesystemet. Rapporten ger en kortfattad introduktion till PODY och går igenom implementeringen i MATCH-systemet.

    Resultat för receptorerna generic crops (POD3gen-CR) och generic deciduous trees (POD1gen-DT) presenteras för åren 2013-2015 och jämförs med motsvarande data från EMEP-modellen. POD3gen-CR uppvisar stor år-till-år variation och MATCH-resultaten är tydligt högre än motsvarande uppskattningar av EMEP-modellen. POD1gen-DT varierar mindre från år till år och resultaten från MATCH och EMEP-modellen överensstämmer bättre.

    PODY presenteras tillsammans med övriga ozonmått på SMHI:s miljöövervakningssida (www.smhi.se/klimatdata/miljo/atmosfarskemi) med start från miljöövervakningsåret 2013.

  • 46.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2015: Extent of Anoxia and Hypoxia, 1960-2015. The major inflow in December 20142016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES. I denna rapport har resultaten från 2014 uppdaterats. De preliminära resultaten för 2015 baseras på data insamlade under Baltic International Acoustic Survey (BIAS) och nationell miljöövervakning med bidrag från Sverige, Finland, Estland, Tyskland och Polen. Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, augusti till oktober, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten. Resultaten för 2014 och de preliminära resultaten för 2015 visar att de extrema syreförhållanden som observerats i Egentliga Östersjön fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots det stora inflöde som inträffade i december 2014 beräknas ungefär 16% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 29% av hypoxi.

  • 47.
    Bengtsson,, Lennart
    et al.
    Gustafsson, Nils
    SMHI, Forskningsavdelningen, Meteorologi.
    Döös, Bo
    Söderman, Daniel
    Helsinki University in Finland.
    Moen, Lars
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Thompson, Thomas
    Jakobsson, Paul
    Bleckert, Gunnar
    Henriksson, Ann-Beate
    Lindgren, Bo
    Kållberg, Per
    SMHI, Forskningsavdelningen, Meteorologi.
    The Meteorological Auto Code (MAC) and Numerical Weather Prediction (NWP) at SMHI2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Sverige var ett föregångsland inom numeriska vädderprognoser och den allra första operativa väderprognosen gjordes redan 1954 på det Internationella Meteorologiska Institutet i Stockholm. SMHI kom igång senare, men 1961 startade man ett långsiktigt program för NWP (numerical weather prediction). Projektet växte gradvis under 1960-talet och blev så småningom en central komponent i SMHIs prognostjänst. En utmaning under de tidiga åren var de begränsade dataresurserna med primitiv programvara, och med dagens mått begränsat minnesutrymme och låg beräkningshastighet. För att kompensera dessa brister krävdes både beslutsamhet och ett stort mått av kreativitet. Som en central komponent i arbetet utvecklade NWP-gruppen datorsystemet MAC (Meteorological Auto Code) som här beskrivs i detalj samt också alla de beräkningsprogram som krävdes för prognostjänsten. Detta inkluderade olika prognosmodeller, analys samt program för databehandling och observationskontroll samt produktion av prognosresultaten i grafisk eller digital form.

    Det är vår förhoppning att f´öreliggande artikel skall ge den yngre generationen en inblick i hur det var att syssla med NWP under 1960-talet.

  • 48.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Axén Mårtensson, Jenny
    SMHI, Samhälle och säkerhet.
    Bergström, Sten
    SMHI, Samhälle och säkerhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Framtidens vattentillgång i Mälaren, Göta älv, Bolmen, Vombsjön och Gavleån Underlag till Dricksvattenutredningen2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Dricksvattenutredningen har, tillsammans med sin referensgrupp för klimatförändringar, valt några orter för mer noggranna fallstudier kring framtida dricksvattenförsörjning. Som ett underlag har SMHI tagit fram denna klimatanalys för de fem ytvattentäkterna Mälaren, Göta älv, Bolmen, Vombsjön och Gavleån.

    Det finns idag en stor risk för översvämningar runt Mälaren, men med en ökad tappningskapacitet vid Slussen och en ny vattendom minskar översvämningsrisken betydligt. Den utökade tappningskapaciteten ger också goda möjligheter att hantera framtidens extrema tillrinningar. Om havsnivåhöjningen blir stor (1 meter globalt) kan nivåerna i Mälaren tidvis bli höga, men översvämningsrisken väntas inte bli lika stor som den är idag. I framtiden beräknas det kunna bli vanligare med låga nivåer i Mälaren.

    Hur stort vattenflödet i Göta älv blir styrs till största delen av vattennivå i Vänern och tappningen från Vänern till Göta älv. I framtidens klimat väntas det bli vanligare med såväl höga som låga nivåer i Vänern. Det leder till att det blir vanligare med både höga och låga vattenflöden i Göta älv. Förhållandena påverkas om regleringsstrategin för Vänern ändras.

    Tillrinningen till Bolmen beräknas i framtiden öka under vintern och minska under vår och sommar. Det väntas bli vanligare med låg tillrinning till sjön medan 100-årstillrinningen väntas öka något i framtiden.

    Medeltillrinningen till Vombsjön beräknas öka något, men skillnaderna mellan årstiderna blir stora med ökad tillrinning vintertid och minskad under sommar och vår. Perioden med låg tillrinning under sommaren väntas bli längre.

    Medelflödet i Gavleån beräknas öka i framtiden, men skillnaderna mellan olika årstider är stora. Vårfloden väntas minska och istället ökar vattenflödena vintertid. Vattenflödena  sommartid beräknas minska och perioden med lågflöden bli längre.

  • 49.
    Samuelsson, Patrick
    et al.
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Gollvik, Stefan
    Kupiainen, Marco
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Kourzeneva, Ekaterina 
    Finnish Meteorological Institute, (FMI), Helsinki, Finland.
    van de Berg, Willem Jan
    Institute for Marine and Atmospheric research Utrecht University, (IMAU), the Netherlands.
    The surface processes of the Rossby Centre regional atmospheric climate model (RCA4)2015Rapport (Övrigt vetenskapligt)
    Abstract [en]

    This report describes the physical processes as part of the surface scheme in the Rossby Centre Regional Atmospheric Climate Model (RCA4). Or more strictly for the version used for the CORDEX downscalings with RCA4. The most important aspects of the surface scheme that are changed with respect to RCA3 are that (i) a new physiography data base is used, (ii) the number of soil layers with respect to soil moisture are increased from two to three and there is also separate soil columns with respect to soil water under forest and open land, respectively, (iii) an exponential root distribution is used, (iv) the density of organic carbon is used to modify soil properties, (v) the prognostic snow albedo is modified to perform better in cold-climate conditions, (vi) Flake is introduced as lake model and lake depth is defined from a global lake-depth data base, (vii) the dynamic vegetation model LPJ-GUESS is introduced for vegetation-climate feedback studies.

  • 50.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Strandberg, Gustav
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Berg, Peter
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Vägledning för användande av klimatscenarier2015Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    SMHI fick i sitt regleringsbrev för år 2014 uppdraget att, i samråd med berörda myndigheter och andra aktörer, ta fram en vägledning för användandet av klimatscenarier. Enligt önskemål framtogs vägledningen som en webb-produkt på smhi.se, i anslutning till klimatscenarier. Materialet finns även samlat i denna rapport, såsom det lanserades hösten 2014. Eftersom materialet är uppbyggt för webb-presentation, där läsaren ska kunna gå in i kapitel utan att ha läst de tidigare, förekommer en del upprepningar. Klimatscenarier är beskrivningar av hur klimatet kan utvecklas i framtiden. Vägledningen ger stöd för att tolka och använda klimatscenarier, med dess möjligheter och begränsningar. Klimateffektstudier beskrivs översiktligt och med fokus på hydrologiska effektstudier. Några enkla steg för att komma igång med klimatanpassning presenteras också. I ordlistan förklaras de begrepp som används.

1234567 1 - 50 av 696
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf
v. 2.35.6