Ändra sökning
Avgränsa sökresultatet
1234567 1 - 50 av 709
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf
Träffar per sida
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 1.
    Lindström, Göran
    SMHI, Forskningsavdelningen, Hydrologi.
    Hydrologiska aspekter på åtgärder mot vattenbrist och torka inom avrinningsområden2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Vattenbrist och torka har varit i fokus i Sverige under senare åren. 2016-2018 var särskilt torra i södra Sverige. Syftet med denna rapport är främst att jämföra de senaste åren med tidigare förhållanden och att anlysera effekten av olika åtgärder mot vattenbrist och torka. Hydrologiska mätserier analyserades, ända sedan 1807 fram till och med 2018. Tonvikten är på perioden från och med 1900, eftersom få stationer var igång innan dess. Vattenföringen minskar inte generellt i Sverige. Lågflödena har ökat i norra Sverige, troligen beroende på milda vintrar på senare år. I sydöstra Sverige har lågflödena i stället minskat, eventuellt delvis på grund av regleringar. 2016-2018 var mycket torra i sydost. Vilket år som har varit torrast beror på var i landet man avser och vad man menar med torrt. Lågflöden analyserades både med statistiska metoder och med den hydrologiska modellen S-HYPE. Osäkerheten i uppskattningar av lågflöden är stor i båda metodvalen. Några sätt att förbättra metodiken föreslås i rapporten. Effekten av olika scenarier beräknades både med en statistisk metod och med S-HYPE. Den faktor som har störst effekt för att höja lågflödena är att man sparar vatten i sjöar, särskilt om man reglerar dem så att vatten sparas till sommaren. De flesta av de simulerade förändringarna i landskapet gav mindre effekt. Sammanfattningsvis är det framförallt vädret och klimatet som avgör vattenflödet. Att det var så torrt åren 2016-2018 beror främst på att det regnade så lite. Effekterna av torrperioder kan mildras genom att man sparar vatten i till exempel sjöar eller dammar.

  • 2. Fagerli, Hilde
    et al.
    Tsyro, Svetlana
    Jonson, Jan Eiof
    Nyíri, Ágnes
    Gauss,, Michael
    Simpson, David
    Wind, Peter
    Benetictow, Anna
    Klein, Heiko
    Mortier, Augustin
    Aas, Wenche
    Hjellbrekke, Anne-Gunn
    Solberg, Sverre
    Platt, Stephen Matthew
    Yttri, Karl Espen
    Tørseth, Kjell
    Gaisbauer, Silke
    Mareckova, Katarina
    Matthews, Bradley
    Schindlbacher, Sabine
    Sosa, Carlos
    Tista, Melanie
    Ullrich, Bernghard
    Wankmüller, Robert
    Scheuschner, Thomas
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Johanson, Lasse
    Jalkanen, Jukka-Pekka
    Metzger, Swen
    van der Gon, Hugo A.C. Denier
    Kuenen, Jeroen J.P.
    Visschedijk, Antoon J.H.
    Barregård, Lars
    Molnár, Peter
    Stockfelt, Leo
    Transboundary particulate matter, photo-oxidants, acidifying and eutrophying components2019Rapport (Refereegranskat)
    Abstract [en]

    This report presents the EMEP activities in 2018 and 2019 in relation to transboundary fluxes of particulate matter, photo-oxidants, acidifying and eutrophying components, with focus on results for 2017. It presents major results of the activities related to emission inventories, observations and modelling. The report also introduces specific relevant research activities addressing EMEP key challenges, as well as technical developments of the observation and modelling capacities.

  • 3.
    Belusic, Danijel
    et al.
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Berg, Peter
    SMHI, Forskningsavdelningen, Hydrologi.
    Bozhinova, Denica
    SMHI, Forskningsavdelningen, Hydrologi.
    Bärring, Lars
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Doescher, Ralf
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Eronn, Anna
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Kjellström, Erik
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Klehmet, Katharina
    SMHI, Forskningsavdelningen, Hydrologi.
    Martins, Helena
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Nilsson, Carin
    Olsson, Jonas
    SMHI, Forskningsavdelningen, Hydrologi.
    Photiadou, Christiana
    SMHI, Forskningsavdelningen, Hydrologi.
    Segersson, David
    SMHI, Forskningsavdelningen, Luftmiljö.
    Strandberg, Gustav
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Climate Extremes for Sweden2019Rapport (Övrigt vetenskapligt)
  • 4.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Matti, Bettina
    SMHI, Samhälle och säkerhet.
    Rasmusson, Kristina
    SMHI, Forskningsavdelningen, Oceanografi.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Modellstudie för att undersöka åtgärdersom påverkar lågflöden: – Delrapport 2 i regeringsuppdrag om åtgärder för att motverkavattenbrist i ytvattentäkter.2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    2018 fick SMHI i uppdrag via myndighetens regleringsbrev att genomföra en studie av åtgärder för att motverka vattenbrist i ytvattentäkter. Arbetet är pågående och har genomförts i flera steg. Detta är den andra delrapporten  som tagits fram i arbetet hittills. Här presenteras resultaten från en förstudie som genomförts med syfte att utvärdera olika åtgärders effekt på lågvattenföring och på så sätt utvärdera dess förmåga att förebygga vattenbrist i ytvattentäkter. Syftet var att lägga grunden för uppbyggnaden av ett interaktivt verktyg där kommuner eller verksamhetsutövare själva ska kunna bedöma vattentillgången vid specifika platser och tidpunkter utifrån uppgifter om olika vattenuttag och regleringar inom avrinningsområdet.

    Störst påverkan på vattentillgången har vädret. Det finns dock åtgärder som kan minska risken för vattenbrist i ytvattentäkter. Åtgärderna är främst för förebyggande arbete, men vissa kan även vara aktuella under en bristsituation.

    Den effektivaste åtgärden för att utnyttja ett områdes vatten är att använda sjöar som reglermagasin för att säkra vattentillgången i vattentäkten, men det förutsätter att det finns sjöar att reglera. I södra Sverige finns oftast en god tillgång på vatten vintertid medan bristsituationer förekommer under sommaren  och början av hösten. Med regleringar kan en del av vattnet från perioder med hög tillgång på vatten samlas i sjöar och tappas av under perioder med låg vattentillgång. Vattenregleringar är vanliga idag, främst för vattenkraftändamål, men förekommer även för dricksvattenförsörjning. SMHI ser att detta är en aspekt som borde tas hänsyn till i områden som riskerar vattenbrist, nu när vattendomar omprövas i stor skala.

    Att utföra åtgärder på diken och andra vattendrag kan ha en lokal effekt, men ger inte tillräckligt stor effekt för att påverka vattenflödena i större skala. Att anlägga våtmarker har också främst en lokal effekt, eftersom det krävs så stora arealer våtmark för att ge effekt på vattentillgången i ytvattentäkter

    I områden med stora vattenuttag påverkas lågflödet om dessa ändras. Eftersom kunskap ofta saknas om vattenuttagens storlek är det svårt att veta hur stor denna effekt blir. Det är också svårt att ta fram föreskrifter som gör att begränsningarna kan genomföras i praktiken. Åtgärder som att införa bevattningsdammar kan ha stor potential förutsatt att de fylls på under tid av högflöden och töms under lågflöden. Effekten blir då att vattenuttag från det naturliga vattendraget minskar under lågflödesperioder.

    Det pågående arbetet med att motverka vattenbrist i ytvattentäkter fokuserar på att utveckla en metodik för hållbar vattenresursförvaltning. Det är tydligt att det behövs gemensamt arbete över alla sektorer med vattenresursplanering i ett avrinningsområde. Det verktyg som nu utvecklas bidrar till att vattenresursplaneringen underlättas och att vattenresurserna kan förvaltas på ett långsiktigt hållbart sätt.

  • 5.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Krunegård, Aino
    SMHI, Samhälle och säkerhet.
    Rasmusson, Kristina
    SMHI, Forskningsavdelningen, Oceanografi.
    Matti, Bettina
    SMHI, Samhälle och säkerhet.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Sveriges vattentillgång utifrån perspektivet vattenbrist och torka: – Delrapport 1 i regeringsuppdrag om åtgärder för att motverka vattenbrist i ytvattentäkter.2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Denna rapport tar upp begreppen torka och vattenbrist ur ett Svenskt perspektiv, undersöker vad som kan ge upphov till vattenbrist och ger en bild av Sveriges vattentillgångar.

    Vattenbrist betyder att det finns ett större behov av rent vatten än vad som finns tillgängligt. Bristen är därför starkt kopplad till användandet av vatten.

    Klimatförändringarna gör Sverige varmare vilket påverkar tillgången till vatten.I genomsnitt väntas vintrarna att bli varmare och mer nederbördsrika vilket leder till mer vatten. Varmare temperaturer innebär också att avdunstningen ökar under sommarhalvåret vilket kan ge en minskad tillgång till vatten, särskilt i södra Sverige. Klimatförändringarna förväntas också leda till kraftigare skyfall. Denna typ av nederbörd kan vara svårt för mark och växter att ta tillvara men kan ge upphov till översvämningar. Mildare vintrar förändrar förutsättningar för snö, vilket särskilt påverkar vattendragen i landets norra delar.

    Under somrarna 2016, 2017 och 2018 fick delar av Sverige uppleva problem med vattenbrist. Orsakerna till de minskade vattentillgångarna var olika och problemen varierade över åren och mellan områden. Delar av landet har de senaste åren fått känna på effekterna av ett varmare klimat. Det har visat hur viktigt det är att vi anpassar oss för att kunna klara dessa förändringar. Det finns många faktorer som påverkar tillgången på vatten i ett område, men följande tre kategorier sammanfattar de flesta faktorer:

    • Klimat – exempelvis nederbörd och temperatur
    • Magasinerande förmåga – hur mycket vatten området kan mellanlagra
    • Vattenanvändning – hur mycket vatten som används

    Som land har Sverige god tillgång till sötvatten. Vattenbrist kan ändå uppstå. Lokalt ser vattentillgången och vattenanvändandet väldigt olika ut vilket kan leda till vattenbrist eller att prioriteringar krävs mellan olika typ av vattenanvändning. Det är tydligt att det behövs gemensamt arbete över alla sektorer med vattenresursplanering i ett avrinningsområde.

  • 6.
    Algotsson, Josefina
    et al.
    SMHI, Samhälle och säkerhet.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Förslag till statusklassning av parameter 9.5 Sötvatteninflöde och vattenutbyte i kustvatten och vatten i övergångszon: En jämförelse mellan Kustzonsmodellens naturliga och normala uppsättning2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Omkring hälften av Sveriges elproduktion utgörs idag av vattenkraft vilken produceras i omkring 2000 kraftverk. Den största avrinningen av vatten från land sker under våren och vattnet lagras i magasin för elproduktion under vintern. Denna förändring av den naturliga avrinningen har stora effekter på de akvatiska ekosystemen och vara ett av de största miljöproblemen för svenska vattendrag och sjöar.Det saknas idag en vägledning för statusklassificering av hydromorfologiska parametrar i kustvatten enligt Vattendirektivet. SMHI fick i uppdrag av Vattenmyndigheterna att ta fram ett förslag till klassgränser och klassning för parameter 9.5 Sötvatteninflöde och vattenutbyte i kustvatten och vatten i övergångszon enligt Havs- och vattenmyndighetens föreskrifter HVMFS 2013:19. Den hydrologiska modellen S-HYPE och den oceanografiska Kustzonsmodellen användes för att studera de skillnader i färskvattentillförsel samt färskvatteninnehåll, salinitet och vattenålder i ytan som orsakas av reglering av vattenflödet på land.Baserat på resultaten har regleringen av vattenflödet på land överlag lett till en ökning av färskvatteninnehållet med 2 % längs Norrlandskusten och en motsvarande minskning av färskvatteninnehållet på västkusten. Typiskt leder regleringen av vatten på land till en lägre färskvattentillförsel till kusten under våren och sommaren och en högre färskvattentillförsel till kusten på hösten och vintern jämfört med ett scenario med en naturlig landavrinning.Den naturliga bakgrundsvariationen, enligt definitionen ± 2 MAD (Median Absolute Deviation), och den Maximala Absoluta Avvikelsen, MAA, användes för att konstruera 5 statusklasser. Denna metod gav upphov till att 98 % av kustvattenförekomsterna fick en Hög eller God status för parametrarna färskvattentillförsel och salinitet, 87 % av kustvattenförekomsterna fick en Hög eller God status för färskvatteninnehåll och 83 % av kustvattenförekomsterna fick en Hög eller God status för vattenålder.

  • 7.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    The Swedish National Marine Monitoring Programme 2018. Hydrography Nutrients Phytoplankton2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten sammanfattar de huvudsakliga resultaten av det svenska nationella marinaövervakningsprogrammet av pelagialen under 2018. Resultat från mätningar av hydrografi,näringsämnen och växtplankton diskuteras för haven runt Sverige; Skagerrak, Kattegatt, Öresund,Egentliga Östersjön, Bottenhavet och Bottenviken. Den nationella miljöövervakningen inomdelprogrammet fria vattenmassan utförs av SMHI (Sveriges meteorologiska och hydrologiska institut),Stockholms Universitet och UMF (Umeå marina forskningscentrum). Data är insamlade, analyseradeoch rapporterade med stöd från svensk miljöövervakning och på uppdrag av HaV (Havs- ochvattenmyndigheten). SMHIs övervakningsprogram sker genom ett samarbete mellan den nationellamiljöövervakningen inom delprogrammet fria vattenmassan och SMHIs oceanografiska mätprogramför övervakning av haven runt Sverige och samfinansieras av HaV och SMHI. Denna årligasammanställning av den nationella miljöövervakningen görs av SMHI i en rapport som finansierasgenom avtalet mellan HaV och SMHI.Vädret under 2018 präglades av hög värme och ett par stormar som fick konsekvenser för tillståndet ihavet. Våren kom snabbt och havsvattentemperaturen ökade mycket mellan april och maj. I augustioch september drog två stormar förbi, benämnda Johanne och Knud, och ytlagret blev på flera håll välomblandat. På östkusten noterades uppvällning både längs med kusten i Egentliga Östersjön och iBottenhavet.Under året var det två mindre djupvatteninflöden till Östersjön och dessa förbättrade syresituationentemporärt i de sydligaste delarna. Ingen förbättring av syresituationen noterades i Östra- och VästraGotlandsbassängen och istället ökade mängden svavelväte i dessa bassänger under året.I mars var vårblomningen igång i Skagerrak och Kattegatt, och koncentrationerna av fosfat och löstoorganiskt kväve var nära eller på detektionsgränsen från april till september. I Skagerrak ochKattegatt dominerades vårblomningen av kiselalgen Skeletonema marinoi. I Östersjön startadevårblomningen i april. Den omfattande blomningen av cyanobakterier i Östersjön var igång redan imaj och var fortfarande pågående under expeditionen i andra halvan av september. Under höstenobserverades dinoflagellaten Prorocentrum compressum i höga cellantal vid alla stationer påVästkusten. Den här flagellaten är sällsynt och även om den inte är skadlig så är det intressant när enart plötsligt dyker upp och stannar under en längre period. Det potentiellt skadliga kiselalgsläktetPseudo-nitzschia blommade i början av december.Koncentrationerna av fosfat och löst oorganiskt kväve i ytvattnet var i huvudsak normala förutom iSkagerrak och Kattegatt där de var lägre än normalt i december. Koncentrationerna av kisel var högreän normalt före vårblomningen vid de flesta stationerna och i Östersjön var de även höga underhösten.Under 2018 var det en del svårigheter med tillgängliga fartyg för expeditionerna och någraexpeditioner behövde ställas in. Många planerade observationer uteblev därför, speciellt undersommarperioden.

  • 8.
    Losjö, Katarina
    et al.
    SMHI, Affärsverksamhet.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    German, Jonas
    SMHI, Affärsverksamhet.
    Uppföljning av de svenska riktlinjerna för bestämning av dimensionerande flöden för dammanläggningar2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    De svenska riktlinjerna för bestämning av dimensionerande flöden (Klass I-flöden) för dammanläggningar publicerades första gången för snart 30 år sedan (Flödeskommittén, 1990). SMHI har på uppdrag av Svenska kraftnät undersökt om de parametrar som används för flödesbestämningarna har förändrats över tiden.

    Riktlinjerna föreskriver att simuleringar med en hydrologisk modell ska användas för beräkningarna, och ett antal parametrar anges för dessa beräkningar. En uppdelning av Sverige i fem regioner gjordes och parametrarna avser

    • ett snötäcke med 30 års återkomsttid
    • en dimensionerande nederbördsekvens över 14 dygn och 1000 km2
    • korrektioner av denna nederbördssekvens med avseende på avrinningsområdets storlek
    • korrektioner av nederbördssekvensen med avseende på årstid
    • extrem vind

    Dessutom framhålls tillämpningen i ett klimat i förändring i den senaste upplagan (Svensk Energi m.fl. 2015).

    För att undersöka om de parametrar som används för flödesbestämningen har förändrats över tiden, och därmed behöver justeras, har analyser gjorts av huruvida det går att se någon trend i nederbörd, snötäcke och extrem vind sedan de första riktlinjerna skrevs.

    Förutom detta har även analyser gjorts av de högsta årliga flöden som uppmätts vid vattenföringsstationer i Sverige för att undersöka om det finns någon trend i dessa data.

    En första uppföljning gjordes för 10 år sedan (Berström, m.fl., 2008) och föreliggande rapport är en uppdatering med tillgång till längre mätserier både efter 2008 och bakåt i tiden.

    Långa serier med mätdata från ett urval av SMHI:s klimatstationer och hydrologiska stationer har använts i analyserna och resultatet av uppföljningen sammanfattas nedan.

    • Utvärdering av den dimensionerande nederbördssekvensen har gjorts dels genom att analysera tillfällen med nederbörd större än 90 mm över 1000 km2 under såväl 24 timmar som två dygn för perioden från c:a 1930 till 2018, och dels av den totala nederbördssumman under en 14-dygnsperiod 1961-2018. Även den högsta stationsnederbörd som varje år uppmätts (punktnederbörd) har analyserats för perioden 1945-2018.
    • Ingen av dessa analyser uppvisar en trend över de analyserade perioderna. Detta står i kontrast mot det resultat som framkom i den uppföljningen 2008, då man konstaterade en trend mot ökande punktnederbörd för perioden 1961-2007.
    • För att undersöka om det finns anledning att justera arealkorrektionen av nederbördssekvensen har såväl den stationsvisa dygnsnederbörden som den ackumulerade 14-dygnsnederbörden över olika stora arealer analyserats. De årliga variationerna är likartade över tid och över landet, och ingen trend kan ses. Anpassningen av de nu analyserade värdena för den ackumulerade 14-dygns nederbörden över 100, 1000 respektive 10 000 km2 ger något olika resultat beroende på analysmetodik. Ingen av metoderna är identisk med den som användes när riktlinjerna togs fram. Ingen entydig avvikelse från riktlinjerna finns dock.
    • Årstidskorrektionen av nederbörden har utvärderats genom att dela upp 14- dygnsnederbörden respektive den observerade punktnederbörden större än 90 mm på de månader den inträffade, dels perioden 1961- 1990 och dels 1991-2018.Resultatet visar att säsongsfördelningen uppvisar ett liknande mönster för de bådaperioderna, och som, även åskådliggörs i Flödeskommittén, (1990), och således finns inget skäl till att justera årstidskorrektionen i riktlinjerna.
    • För utvärderingen av eventuella trender i snötäcket har analyser gjorts av medelvärdet av varje års största snödjup vid 42 klimatstationer. Variationerna är stora mellan år under hela den analyserade perioden i hela landet, och även ett flytande 10-årsmedelvärde varierar. Sett över hela perioden 1904/05–2017/18 kan dock ingen trend ses, och inte heller för perioden 1961-2018, utan endast variationer över kortare tid. Eftersomberäkningar av 30-årssnön förutsätter att ingen trend finns i tidsserien som används för den statistiska analysen, kvarstår rekommendationen i riktlinjerna att frekvensanalysen för snön ska göras för så lång period som data finns tillgängliga.
    • Analysen av varje års högsta dygnsmedelvärde på vattenföringen har gjorts för 69 oreglerade eller endast obetydligt reglerade vattenföringsstationer med långa tidsserier. Antalet stationer varierar för olika delar av landet, men analysresultatet visar inte på någon långsiktig trend i storleken av flödestopparna.
    • Den geostrofiska vinden, som är en slags idealiserad genomsnittlig vindhastighet beräknad från lufttrycksobservationer, har beräknats, uppdelat i nio områden fördelade över Sverige. Antalet tillfällen från och med 1940 med geostrofisk vind på minst 25 m/s uppvisar ingen långsiktigt trend som kan föranleda justeringar i kriterierna för beräkningen av vågor och seicher.
    • Analysen av förhållanden mellan Klass I-avrinningen och 100-årsflödet tyder på att kvoten ökar med minskande avrinningsområden. Här kan det finnas en anledning att följa utvecklingen vid nya beräkningar för att eventuellt kunna se något orsakssamband.

    Slutsatsen är att inga förändringar av kriterierna i riktlinjerna för beräkning av dimen- sionerande flöden för dammanläggningar behöver göras i dagsläget. Likaså framkommer vikten av långa tidsserier som underlag för bedömning av trender.

  • 9.
    Algotsson, Josefina
    et al.
    SMHI, Samhälle och säkerhet.
    Van Der Stelt, Frank
    SMHI, Affärsverksamhet.
    Abdoush, Diala
    SMHI, Samhälle och säkerhet.
    Swedish coastal water bodies on Wikidata Combining WFD data with Wikidata2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I enlighet med Vattendirektivet rapporterar Vattenmyndigheterna miljöinformation om Sveriges ytvattenförekomster till EU.Under Naturvårdsverkets regeringsuppdrag Smartare miljöinformation togs initiativet upp att visualisera den till EU rapporterade miljöinformationen om Sveriges kustvattenförekomster på Wikidata och Wikipedia. SMHI har lett initiativet med stöd från Wikimedia Sverige, Vattenmyndigheten för Södra Östersjöns vattendistrikt, Jönköpings länsstyrelse och volontärer från Wikimedias gemenskap.Syftet med arbetet var att göra miljöinformation om Sveriges kustvattenförekomster mer tillgänglig för allmänheten, sprida kunskap om statusklassning samt skapa förutsättningar att öka miljömedvetenheten hos allmänheten. Projektet har resulterat i att:• 653 nya kustvattenförekomster beskrivs på Wikidata.• Artiklar om vattenförvaltning i Sverige, kustvattenförekomster och databasen SVAR har skapats på Wikipedia.• En mall för informationsrutor på Wikipedia har tagits fram och kan automatiskt hämta och visa information om kustvattenförekomsters statusklassning från Wikidata.• Mallen för informationsrutor om kustvattenförekomster används i artiklar om kustvatten på Wikipedia.• Information på smhi.se om SMHIs datapolicy är uppdaterad.• Licensen för databasen SVAR är fastställd till CC0 vilket förenklar användningen av informationen och öppnar möjligheten att använda den på fler sätt än tidigare.

  • 10.
    Langner, Joakim
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord Wylde, Helene
    SMHI, Affärsverksamhet.
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    Mapping of phytotoxic ozone dose for birch, spruce, wheat and potato using the MATCH-Sweden system2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Vi har lagt till beräkningar av PODY för björk, gran vete och potatis i MATCHSverigesystemet. Rapporten går igenom de förändringar och uppdateringar som harinförts i beräkningarna sedan den ursprungliga implementeringen 2016.Resultat för receptorerna generic crops (POD3gen-CR), generic deciduous trees (POD1gen-DT), birch (POD1spec-birch), spruce (POD1spec-spruce), wheat (POD6spec-whet), potato (POD6specpotato),presenteras för åren 2013-2017.En jämförelse med resultat från EMEP-modellen för generic crops och för genericdeciduous trees ger en bättre överensstämmelse än tidigare. Givet att ett fel i beräkningenav solstrålningen har identifierats i EMEP-modellen så framstår resultaten från MATCHSverigeoch EMEP nu som mer konsistenta.Variationen från år till år i PODY för björk och gran är av samma storleksordning somden som beräknas för generic deciduous trees, men numeriska värden för PODY skiljersig, framför allt för björk beroende på skillnader i de parametrar som ingår i beräkningenoch på användning av längre vegetationsperioder baserade på svenska och skandinaviskadata. Kritiska nivåer motsvarande 4 % reduktion i tillväxten av björk och gran överskridsi stort sett i hela landet för alla år som har studerats.Variationen från år till år i PODY för vete och potatis är större än för generic crops pågrund av att ett högre tröskelvärde används i beräkningen av PODY för de specifikagrödorna. Kritiska nivåer motsvarande skördeförluster på 5 % uppnås i södra delen avSverige för fyra av de fem studerade åren för vete och för två av åren för potatis.Det uppdaterade programpaketet för PODY-beräkningar skulle kunna användas förberäkningar av PODY för olika typer av vegetation för perioden 1990-2013 baserat pååteranalyserade ozonkoncentrationer. Programpaketet kan också utvecklas förberäkningar av PODY för hela Europa baserat på olika typer av utsläpps- ochklimatsscenarier.PODY presenteras tillsammans med övriga ozonmått på SMHI:s miljöövervakningssida(www.smhi.se/klimatdata/miljo/atmosfarskemi) med start från miljöövervakningsåret2013.

  • 11.
    Sjökvist, Elin
    et al.
    SMHI, Affärsverksamhet.
    Abdoush, Diala
    SMHI, Samhälle och säkerhet.
    Sommaren 2018 - en glimt av framtiden?2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Vädret sommaren 2018 var extremt sett till vad vi upplevt under 1900-talet. Den långvariga värmen gav nya värmerekord och i kombination med mindre nederbörd än normalt utbredd torka. Torkan ledde till skogsbränder och påfrestning på lantbruk och djurhållning. Värmeböljorna orsakade också hälsoproblem och fler dödsfall än normalt noterades under sommaren. Var sommaren 2018 en glimt av framtiden? Motsvarar sommaren 2018 vad som kan komma att bli en medelsommar i slutet av seklet?

    För att svara på den frågan jämförs här sommaren 2018 med beräknade medelvärden för en 30-årsperiod i slutet av seklet. Dessa klimatscenarier har SMHI tidigare publicerat i länsvisa rapporter. Denna rapport är tänkt att vara till hjälp för de samhällsfunktioner som vill utvärdera hur sommaren 2018 påverkat verksamheten och vad vi kan förvänta oss av framtiden.

    Analyserna i rapporten visar att de parametrar som väljs för att studera klimatet har stor betydelse för resultatet. Medeltemperaturen för sommarmånaderna visar att sommaren var två till drygt tre grader varmare än perioden 1961-1990. Det är ungefär lika mycket som beräknas enligt scenario RCP4.5 (medelhöga utsläpp) till slutet av seklet. Men månadsvis statistik visar att både maj och juli 2018 var mer än fem grader varmare än normalt på flera platser. Det motsvarar beräknad ökning i RCP8.5 (höga utsläpp) till slutet av seklet.

    Jämförelserna av högsta dygnsmedeltemperatur, antal varma dagar och kylbehov för sommaren 2018 varierar geografiskt men motsvarar förväntad ökning mitt emellan scenarierna RCP4.5 och RCP8.5 i slutet av seklet. Årets längsta värmebölja är mycket likt det beräknade medelvärdet enligt RCP8.5 i slutet av seklet för Östersjökusten. För övriga Sverige hamnar resultaten mitt emellan RCP4.5 och RCP8.5.

    Sommaren 2018 var mycket nederbördsfattig och torr. I de klimatscenarier som analyseras här råder en viss osäkerhet kring om nederbörden ökar eller minskar i södra Sverige i framtiden, men inget av scenarierna visar att nederbördsmängderna sommaren 2018 blir vanliga i framtiden.

    Antalet dagar med lågflöde var många under sommaren 2018 och i Norrland fler än vad klimatscenarierna visar i medeltal för slutet av seklet. I södra Sverige var situationen jämförbar med medelvärdet enligt RCP8.5 i slutet av seklet.

    Små nederbördsmängder i kombination med hög temperatur orsakade torra marker i hela landet. Södra Götaland var extremt torrt jämfört med 1961-1990 och torrare än en medelsommar i slutet av seklet oavsett scenario. Mellersta Sverige uppvisar samma nivå som medelvärdet i RCP8.5 i slutet av seklet medan norra Sverige väntas bli torrare än sommaren 2018 i framtiden.

    Analyserna ger var för sig en bild av hur sommaren 2018 förhåller sig till det framtida klimat som finns beskrivet i SMHIs länsanalyser. En sommar som 2018 kan förekomma i slutet av seklet oavsett nivå av framtida utsläpp av växthusgaser, men sannolikheten att den förekommer är olika för olika väderparametrar och ändras med ökad klimatpåverkan.

  • 12.
    Josefsson, Weine
    SMHI, Samhälle och säkerhet.
    Long-term global radiation in Stockholm, 1922-20182019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    År 1922 inleddes mätningar av globalstrålningen i Stockholm. Under åren har SMHI använt olika instrumenttyper, insamlingssystem och även flyttat mätplatsen inom staden. Denna typ av förändringar orsakar, små ibland större, men betydelsefulla systematiska förändringar i den uppmätta globalstrålningen. Därför kan det finnas betydande osäkerheter i direkta jämförelser av data från olika perioder. I föreliggande rapport visas hur data granskats, ibland rättats, kompletterats och korrigerats för kända mätfel till ett slutligt data-set, som förhoppningsvis bättre ska kunna användas för studier av den långsiktiga variationen av globalstrålning i Stockholm än de ursprungliga mätningarna.Under arbetet uppstod behov av att använda solskenstidsobservationer. Dessa har därför digitaliserats, granskats och vid behov rättats så att en någorlunda homogen serie erhållits på månadsnivå. Information om detta finns i Appendix 3.

  • 13.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet.

    IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom.

    I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras ävenkunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 14.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Refereegranskat)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet. IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom. I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras även kunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 15.
    Andersson, Stefan
    et al.
    SMHI, Affärsverksamhet.
    Arvelius, Johan
    SMHI, Affärsverksamhet.
    Jones, Jörgen
    SMHI, Affärsverksamhet.
    Kindell, Sven
    SMHI, Affärsverksamhet.
    Leung, Wing
    SMHI, Affärsverksamhet.
    Beräkningar av emissioner och halter avbenso(a)pyren och partiklar frånsmåskalig vedeldning: Luftkvalitetsmodellering för Skellefteå, Strömsunds och Alingsås kommuner2019Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna studie har emissioner och halter i utomhusluften av benso(a)pyren (B(a)P) samt partiklar (PM2.5) beräknats för Skellefteå, Strömsunds och Alingsås kommuner avseende småskalig uppvärmning. Emissioner har beräknats för hela kommunerna, medan luftkvalitet har modellerats för två tätorter i varje kommun; Boliden och Bureå i Skellefteå kommun, Backe och Hoting i Strömsunds kommun samt Alingsås och Sollebrunn i Alingsås kommun. De tre kommunerna valdes då de identifierades ha höga B(a)P-halter i den tidigare nationella B(a)P-kartläggningen samt tillgång till sotarregister av tillräcklig bra kvalitet; tätorterna valdes genom att analysera emissionsberäkningarna i varje kommun och välja ut tätorter med de högsta emissionerna.

    Syftet med studien är undersöka hur B(a)P- och PM2.5-halterna i Sverige förhåller sig till miljökvalitetsnormer, utvärderingströsklar samt preciseringen av miljökvalitetsmålet Frisk luft och analysera hur stort gapet är för att klara dessa. Detta genom spridningsmodellering samt utvärdering mot mätningar i fem av tätorterna. Osäkerheterna i den tidigare gjorda nationella karteringen av B(a)Phalter från småskalig vedeldning (Andersson et al., 2015), som ska ses som en preliminär bedömning av halterna, utvärderas också. Vidare undersöks, genom känslighetsanalys, hur antaganden om emissionsfaktorer och eldvanor påverkar luftkvaliteten i områdena. En av de åtgärder som utreds är att byta ut gamla vedpannor mot moderna eldstäder. Luftmiljövinsterna av detta undersöks också genomspridningsmodellering.

    Emissionerna från eldstäderna har beräknats utifrån information från sotarregister i de olika kommunerna, där eldstäderna har klassificerats som vedpannor (miljögodkända och ickemiljögodkända), lokaleldstäder, flis- och pelletspannor samt övriga pannor (mest oljepannor). Geolokalisering, dvs. framtagandet av koordinater, har gjorts för de olika eldstäderna i registren baserat på adresser. Med hjälp av modellerade energibehov för ett genomsnittligt meteorologiskt kalenderår för perioden 1960-1990, för ett genomsnittligt småhus, samt antaganden om emissionsfaktorer, eldstäders nyttjandegrad samt verkningsgrad har sedan emissionerna beräknats.

    Lokalskalig spridningsmodellering med en rumslig upplösning om 20 m × 20 m har genomförts för de utvalda tätorterna med den Gaussiska lokalskaliga spridningsmodellen Dispersion, som är samma lokala modell som finns i modellsystemet SIMAIR-ved. Vid spridningsmodelleringen har meteorologiska data från Mesan för kalenderår 2016 och 2017 använts. Bakgrundshalter har inkluderats för PM2.5, men enbart lokalt haltbidrag från småskalig uppvärmning har beräknats för B(a)P; ett schablontillägg av bakgrundshalter för B(a)P har gjorts för varje tätort. Modelleringen har också utvärderats mot preliminära mätresultat (månadsprovtagning) av B(a)P avseende juni- december 2017 i Boliden, Bureå, Backe, Hoting samt Alingsås tätort samt mätningar av PM2.5 i Bureå och Backe (mätningarna har utförts av Svenska Miljöinstitutet IVL på uppdrag av Naturvårdsverket)

  • 16. Fagerli, Hilde
    et al.
    Tsyro, Svetlana
    Jonson, Jan Eiof
    Nyíri, Ágnes
    Gauss, Michael
    Simpson, David
    Wind, Peter
    Benedictow, Anna
    Valdebenito, Alvaro
    Klein, Heiko
    Schulz, Michael
    Mortier, Augustin
    Aas, Wenche
    Hjellbrekke, Anne-Gunn
    Solberg, Sverre
    Platt, Stephen Matthew
    Yttri, Karl Espen
    Rud, Richard Olav
    Tørseth, Kjetil
    Mareckova, Katarina
    Matthews, Bradley
    Tista, Melanie
    Wankmüller, Robert
    Posch, Maximilian
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Lazzeri, Paolo
    Pandolf, Marco
    Luoma, Krista
    Aurela, Minna
    Lenartz, Fabian
    Bergmans, Benjamin
    Pittavino, Sara
    Tombolato, Ivan
    Transboundary particulate matter, photo-oxidants, acidifying and eutrophying components2018Rapport (Övrigt vetenskapligt)
  • 17.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2018 - Extent of Anoxia and Hypoxia, 1960-20182018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES datacenter. I denna rapport har resultaten från 2017 uppdaterats och preliminära resultat för 2018 tagits fram. Resultaten för 2018 baseras på data insamlade under internationella fiskeriundersökningar, nationell miljöövervakning och forskningsprojekt med bidrag från Danmark, Estland, Lettland, Sverige, Finland, Ryssland och Polen. Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten. Resultaten för 2017 och de preliminära resultaten för 2018 visar att de extrema syreförhållanden som observerats i Egentliga Östersjön, efter regimskiftet 1999, fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots ett flertal inflöden under perioden 2014-2016 beräknas ungefär 22% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 32% av hypoxi under 2018. De preliminära resultaten från 2018 indikerar att de anoxiska områdena är de största som har noterats under den analyserade perioden, som startar 1960. Mängden svavelväte, som på grund av inflödena 2014- 2016, helt försvann från Östra och Norra Gotlandsbassängerna, ökar åter i dessa bassängers djupvatten.

  • 18.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Wikberger, Christina
    Amorim, Jorge Humberto
    SMHI, Forskningsavdelningen, Luftmiljö.
    Klimatanpassa nordiska städer med grön infrastruktur2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Förtätning av städer och pågående klimatförändring ökar behovet av anpassningsåtgärder. Grön infrastruktur och naturbaserade lösningar kan bidra till att skapa mer hälsosamma och långsiktigt hållbara städer. För att öka användningen av grön infrastruktur som en del i klimatanpassningen behöver vi förstå vilka kunskapsluckor och andra hinder som ligger i vägen för att grön infrastruktur ska användas i klimatanpassningsarbetet.

    SMHI har under år 2018 tillsammans med Stockholms stad drivit det av forskningsrådet Formas finansierade projektet ”Grön infrastruktur och klimat i nordiska städer: idag och i framtiden”. Sammanställningen av rapporter och workshops i projektet visar att det finns mycket kunskap och tillgängliga exempel på hur urbana gröna lösningar kan se ut. Det saknas dock svar på de kvantitativa effekterna av olika åtgärder avseende till exempel temperatur, luftkvalitet, påverkan på hälsa och sociala aspekter.

    De åtgärder som i dag görs i nordiska städer baseras huvudsakligen på behovet av att lösa dagvattenfrågor. Det finns få exempel på städer som använder grön infrastruktur och naturbaserade lösningar som klimatanpassningsåtgärder när det gäller värme. Samtidigt är aktörerna medvetna om övriga positiva effekter som tillkommer såsom trivsel, svalka och biologisk mångfald.

    Eftersom grön infrastruktur och naturbaserade lösningar är ganska nya åtgärder i klimatanpassningsarbetet så saknas oftast erfarenheter av långtidseffekter. Skötsel kan vara ett problem, trots bra anvisningar. Aktörerna pekar också på behovet av att engagera de boende kontinuerligt. Det tycks handla om att skapa en djupare förståelse för varför anläggningar ser ut som de gör och hur de ska skötas.

    Vid workshops och webbinarium efterfrågades vilka kunskapsluckor deltagarna såg. Ekonomi och kunskap om effekter lyftes fram tydligt i svaren. Dessutom önskades metoder för anläggning och drift, goda exempel, planeringsverktyg och underlag om temperatur och vatten.

    Ekonomi och kunskapsbrist ansågs som hinder för genomförande, vilket framkom vid workshops och webbinarium. Andra hinder som nämndes var politiska beslut, lagstiftning, avsaknad av riktlinjer, förtätning och konkurrens om mark liksom planerings- och samordningssvårigheter. En tröghet i att ändra traditionellt planerande och utförande pekades också ut som hinder. Många efterfrågar kunskap allmänt. Vår förhoppning är att denna rapport kan bidra till att inspirera och informera om var material finns. 

  • 19.
    Karlson, Bengt
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Mohlin, Malin
    Hu, Ye O.O.
    Andersson, Anders F.
    Miljöövervakning av växtplankton i Kattegatt och Östersjön med rDNA-barcoding och mikroskopi: En jämförelse av molekylärbiologisk metodik och mikroskopi.2018Rapport (Övrigt vetenskapligt)
  • 20.
    Andersson, Camilla
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord Wylde, Helene
    SMHI, Affärsverksamhet.
    Engardt, Magnuz
    SMHI, Forskningsavdelningen, Luftmiljö.
    Long-term sulfur and nitrogen deposition in Sweden: 1983-2013 reanalysis2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Ett unikt långt dataset (1983-2013) för svavel- och kvävedeposition har skapats för Sverige samt Östersjön och omgivande länder. Det baseras på kvalitetsgranskade mätningar och modellfält, kombinerade genom avancerade metoder för att fånga spatiala och temporala variationer. Datasetet kan användas för att beskriva trender i deposition till olika relevanta marktyper.Återanalysen stämmer väl överens med mätningar, men vi har identifierat skillnader i torrdeposition till barrskog. Detta visar på behov av djupare studier och metodikförbättringar för bestämning av torrdeposition.Vi rekommenderar mer avancerade metoder för att beskriva spatial variation än genom medelvärdesbildning eller spatial interpolering av uppmätt deposition.Vi finner en markant minskning från 1980-talet fram till idag för både svavel- och kvävedeposition (med cirka 80 % respektive 30 %).Kritiska belastningar till både barr- och lövskog, fjällmarker och våtmarker har överskridits framförallt i sydvästra Sverige, men också i sydöstra Sverige och södra fjällen. Situationen förbättras men överskridanden sker fortfarande även över större områden.

  • 21.
    Leung, Wing
    et al.
    SMHI, Affärsverksamhet.
    Windmark, Fredrik
    SMHI, Affärsverksamhet.
    Brodl, Ludvik
    SMHI, Affärsverksamhet.
    Langner, Joakim
    SMHI, Forskningsavdelningen, Luftmiljö.
    A basis to estimate marginal cost for air traffic in Sweden.: Modelling of ozone, primary and secondary particles and deposition of sulfur and nitrogen.2018Rapport (Övrigt vetenskapligt)
    Abstract [en]

    In this study we have investigated the effects of emissions from aviation on air quality in both Swedish and European domains. The results will be used as a basis to estimate the marginal cost for air traffic in Sweden. The vertical, geographical and temporal distribution of aviation emissions over Sweden has been estimated using a newly developed methodology. The aviation emissions have been categorized by their emission altitude (LTO, low cruise and high cruise) and flight nationality (international, national and overflight). This aviation emission information was then used as input data to the regional atmospheric chemistry model MATCH to simulate the effects of aviation emissions on ecosystem, health and climate metrics. A total of 17 model simulations over three years have been performed. There is one simulation in which all emitted species from the surface and aviation emissions are included and eight simulations in which all aviation emissions from each combination of emission altitude and flight nationality are included. There are eight simulations in which NOx aviation emissions from each combination of emission altitude and flight nationality are included. Using these simulations, contributions from aviation emissions to deposition, concentrations and a range of different air pollution metrics has been calculated. The results are calculated in both the Europe and Swedish domains for all the simulations. 

    The following results are included in this report: . Deposition of oxidised and reduced nitrogen . Deposition of excess sulfur . AOT40 and SOMO35 and their exposures . Concentration and exposure of primary and secondary particles . Concentration of nitrate and sulfate particles . Concentration of surface and above surface ozone 

    In summary, contributions from aviation emissions in Sweden to the different concentrations, deposition and metrics for environmental effects are generally small, on the order of a few per mille or less. However the impacts can be traced in the simulations well beyond the Swedish borders. LTO emissions give the largest contribution to deposition of oxidised and reduced nitrogen, deposition of excess sulfur and concentrations of primary and secondary particles. In particular near the major airports like Stockholm-Arlanda and Gothenburg-Landvetter. High cruise emissions give insignificant contributions to deposition and concentrations at surface level. LTO emissions give a negative contribution to surface ozone concentration locally at the main Swedish airports but give an overall increased contribution in the regions around. Aviation emissions at low cruise and high cruise levels have the largest effect on ozone concentrations at higher levels. 

  • 22. Colette, Augustin
    et al.
    Schucht, Simone
    Ciarelli, Giancarlo
    Létinois, Laurent
    Meleux, Frédérik
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    Cuvelier, C.
    Manders, A.
    Mar, K.A.
    Mircea, M.
    Pay, T.
    Raffort, V.
    Tsyro, S.
    Adani, M.
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Bessagnet, G
    Briganti, A.
    Cappelletti, A.
    Couvidat, F.
    D'Isidoro, M.
    Fagerli, H.
    Ojha, N.
    Otero, N.
    Wind, P.
    Long-term air quality trends in Europe Fine Particulate Matter (PM2.5) Health Impacts.2018Rapport (Övrigt vetenskapligt)
  • 23.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    The SwedishNational MarineMonitoringProgramme 2017: HydrographyNutrientsPhytoplankton2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten sammanfattar de huvudsakliga resultaten av det svenska nationella marina övervakningsprogrammet av pelagialen under 2017. Resultat från mätningar av hydrografi, näringsämnen och växtplankton diskuteras för  haven runt Sverige; Skagerrak, Kattegatt, Öresund, Egentliga Östersjön, Bottenhavet och Bottenviken. Övervakningen utförs av SMHI (Sveriges meteorologiska och hydrologiska institut), SU (Stockholms Universitet) och UMF (Umeå marina forskningscentrum) och övervakningsprogrammet samfinansieras av HaV (Havs- och vattenmyndigheten), SMHI, SU and UMF. Data är insamlade, analyserade och rapporterade med stöd från svensk miljöövervakning och på uppdrag HaV.

    Den Baltiska strömmen längs Västkusten medför stora fluktuationer av  salthalten i ytan och det ovanligt höga utflödet med bräckt vatten från Östersjön under 2017 avspeglades som låg ytsalthalt i Skagerrak och Kattegatt i början av året. Det var inga stora djupvatteninflöden till Östersjön under 2017 men ett par av mindre storlek. Dessa mindre inflöden förbättrade syreförhållanden endast temporärt i Bornholms-bassängen och i södra delen av Östra Gotlandsbassängen.

    Salthalten under haloklinen var högre än normalt i Gotlands-bassängerna och i Norra Egentliga Östersjön samt även i ytlagret i Östra Gotlandsbassängen.

    Koncentrationen av fosfat och oorganiskt kväve i Skagerrak och Kattegatts ytvatten var normal medan silikatkoncentrationen var hög, speciellt under våren. I Östersjöns ytvatten var det höga nivåer av silikat i alla bassänger. Enligt det uppskattade totala innehållet av kisel i Östersjön har det pågått en ökning av kisel sedan början av 90-talet. Koncentrationen av fosfat i ytvattnet var över normal i Gotlandsbassängerna och Norra Egentliga Östersjön medan koncentrationen av oorganiskt kväve var mer än normalt i Arkona- och Bornholmsbassängen. Under vår och sommar var det djup där det oorganiska kvävet tar slut i Egentliga Östersjön större än normalt. I djupvattenlagret var det lägre koncentrationer än normalt av särskilt fosfat och silikat.

    I stället för de sedvanliga kiselalgerna var det det för fisk skadliga flagellatsläktet Pseudochattonella som blommade på Västkusten i februari till april. Under hösten förekom däremot en utdragen kiselalgsblomning. I Östersjön förekom vårblomningen i april. Cyanobakterieblomningen startade redan i maj med Aphanizomenon flos-aquae. Under juni och juli fanns alla tre av de filamentösa cyanobakterierna, A. flos-aquae, Dolichospermum lemmermannii och den potentiellt skadliga Nodularia spumigena, i växtplanktonproverna i varierande mängd.

    I Bottenhavet var ytvattentemperaturen lägre än normalt och koncentrationen av syre var under normala nivåer, men ändå högre än kritiska.

  • 24.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2017 - Extent of Anoxia and Hypoxia, 1960-20172018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES. I denna rapport har resultaten från 2016 uppdaterats. De preliminära resultaten för 2017 baseras på data insamlade under Baltic International Acoustic Survey (BIAS) och nationell miljöövervakning med bidrag från Sverige, Finland och Polen.

    Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten.

    Resultaten för 2016 och de preliminära resultaten för 2017 visar att de extremasyreförhållanden som observerats i Egentliga Östersjön fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots ett flertal inflöden under perioden 2014-2016 beräknas ungefär 18% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 28% av hypoxi under 2017. Inflödena 2014-2016 har minskat poolen av svavelväte så att den nästan helt försvunnit i Östra och Norra Gotlandsbassängen. Dock är syrgashalterna fortsatt noll eller mycket nära noll i djupvattnet och tecken på ökade halter av svavelväte har noterats under 2017.

  • 25.
    Lindström, Göran
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Bartosova, Alena
    SMHI, Forskningsavdelningen, Hydrologi.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Strömqvist, Johan
    SMHI, Forskningsavdelningen, Hydrologi.
    Uppehållstider i ytvatten i relation tillvattenkvalitetNET, ett generellt uppskalningsverktyg2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    NET är ett verktyg för uppskattning av vattenburen transport av olika ämnen i punkter där detsaknas mätningar. Verktyget togs ursprungligen fram inom forskningsprogrammet ”Climatechange and the Environmental Objectives” (CLEO, Munthe et al., 2014 och 2016). Tanken äratt NET ska vara generellt, och kunna användas för simulering av olika ämnen, men endastberäkna medelvärden över tiden av mängder och koncentrationer. Ofta är det mängder som ärslutmålet för en beräkning, varför det i vissa situationer kan finnas mycket att vinna på attanvända en enkel och snabb beräkningsmodell. Inom CLEO simulerades flöden av totalkväve,total-fosfor och totalt organiskt kol.

  • 26.
    Olsson, Jonas
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Berg, Peter
    SMHI, Forskningsavdelningen, Hydrologi.
    Eronn, Anna
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Simonsson, Lennart
    SMHI, Forskningsavdelningen, Hydrologi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Yang, Wei
    SMHI, Forskningsavdelningen, Hydrologi.
    Extremregn i nuvarande och framtida klimat Analyser av observationer och framtidsscenarier2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Studien har främst omfattat analyser av extrem korttidsnederbörd i observationer från SMHIs nät av automatiska meteorologiska stationer. Även analyser av korttidsnederbörd från kommunala mätare, manuella meteorologiska stationer, väderradar och klimatmodeller har genomförts. De huvudsakliga slutsatserna från detta uppdrag kan sammanfattas enligt följande.

    • En regionalisering av extrem korttidsnederbörd (skyfall) i Sverige gav fyra regioner: sydvästra (SV), sydöstra (SÖ), mellersta (M) och norra (N) Sverige. Ytterligare indelning kan göras men i denna studie prioriterades att ha regioner av denna storleksordning för att få ett ordentligt underlag för regional statistik. Regionaliseringen gäller enbart korttidsnederbörd, upp till maximalt 12 tim varaktighet.
    • Den regionala statistiken uppvisar tämligen distinkta geografiska skillnader, med högst värden i region SV och lägst i region N. Det är inte förvånande att vårt avlånga land uppvisar regionala skillnader då varmare och fuktigare luftmassor förekommer mer i söder än i norr, och därmed ökar förutsättningarna för intensiv nederbörd. Den regionala statistiken överensstämmer överlag väl med motsvarande statistik i våra grannländer.
    • Under perioden 1996-2017 finns inga tydliga tidsmässiga tendenser vad gäller skyfallens storlek och frekvens i de olika regionerna, utan dessa ligger överlag på en konstant nivå. Inte heller extrem dygnsnederbörd sedan 1900 uppvisar några tydliga tendenser på regional nivå. På nationell nivå indikeras en svag ökning av dels landets högsta årliga nederbörd sedan 1881, dels förekomsten av stora, utbredda 2-dygnsregn sedan 1961.
    • Skyfallsstatistik baserad på nederbördsobservationer från väderradar som justerats mot interpolerade stationsdata (HIPRAD) överensstämmer väl med stationsbaserad statistik för korta varaktigheter (upp till 2 tim) i södra Sverige. För längre varaktigheter och i mellersta och norra Sverige överskattar HIPRAD regnvolymerna.
    • Analyser av de senaste klimatmodellerna (Euro-CORDEX) indikerar en underskattning av extrema regnvolymer för korta varaktigheter (1 tim) men överlag en realistisk beskrivning av observerad skyfallsstatistik. Den framtida ökningen av volymerna beräknas ligga mellan 10% och 40% beroende på tidshorisont och koncentration av växthusgaser, vilket överlag ligger nära tidigare bedömningar.

    Både för bedömningen av regionala skillnader och historiska klimateffekter är det av största vikt att bibehålla, eller ännu hellre utöka, observationerna av korttidsnederbörd i Sverige. Nederbördsmätning via alternativa tekniker bör kunna användas i allt högre utsträckning framöver för förbättrad kunskap och statistik. Väderradar är redan etablerat och den digitala utvecklingen öppnar även möjligheter till insamling av nederbördsdata och relaterad information via mobilmaster, uppkopplade privata väderstationer, sociala medier, etc. Denna utveckling måste bevakas, utvärderas och i största möjliga utsträckning utnyttjas.

  • 27.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden. Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra största sjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren är mycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är det Vänern som har de största problemen i dagens klimat och fram till slutet av detta sekel, medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längre tidsperspektiv.

    Klimatförändringarna medför bland annat förändrade vattennivåer, förändrade vattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilket ger konsekvenser för olika intressen runt sjöarna.

    En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte är tydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är ett hinder för att komma vidare med de problem som idag finns för Vänern och för den långsiktiga klimatanpassningen av Mälaren, bortom detta sekel.

    Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring:

    • Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna
    • Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vatten och kortare perioder med is.
    • Modellering av hur råvattenkvaliteten förändras i framtiden.
    • Mer observationer för att fånga upp klimateffekter i sjöarna.

    Till varje sjö har en referensgrupp bestående av representanter för olika intressen kring sjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inom ramen för projektet och frågeställningar som kommit upp under möten med referensgrupperna, men även befintlig litteratur har använts.

  • 28.
    Södling, Johan
    et al.
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Statistisk metodik för beräkning av extrema havsvattenstånd2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Som ett led i arbetet att förbättra metoderna för planeringsunderlag gällande extrema havsvattenstånd har SMHI gjort en inventering av statistiska metoder för extremvärdesanalys. Metoderna är vanligt förekommande när olika dimensioneringsunderlag tas fram. För att ta fram statistik med hög tillförlitlighet för händelser som har låg sannolikhet (hög återkomsttid) har dock metoderna begränsad användning.

    Tre huvudsakliga metoder har applicerats på SMHI:s havsvattenståndsdata. Den mest vanliga, Blockmaximum-metoden, används vanligtvis på årshögsta vattenstånd. POT – metoden (Peak Over Threshold), använder fler data och är inte lika vanlig. I Norge används en variant av POT – metoden, den så kallade ACER-metoden (Average Conditional Exceedance Rate). Den är mycket lämplig för att ta fram värden för lägre återkomsttider, och är förhållandevis robust när data läggs till vartefter.

    Metodernas lämplighet och känslighet utvärderades för extrema havsvattenstånd, alltså havsvattenstånd med höga återkomsttider(låg sannolikhet). Slutsatsen är att det inte går att välja en metod som överlägsen den andra, och att kunskap om den aktuella platsens oceanografiska förhållanden behövs för att utvärdera resultatens rimlighet. I alla analyser av extrema havsvattenstånd är det viktigt att beakta datakvalité och dataseriens längd. Resultat bör redovisas med konfidensintervall.

    Blockmaximum-metoden testades med olika fördelningar. Gumbel-fördelning visar sig kunna ge orimliga nivåer för vattenståndsextremer och rekommenderas därför inte. GEV (Generalized Extreme Value) och Log-normal fördelning används med fördel i kombination.POT-metoder tar till vara fler händelser än de riktigt extrema, men resultaten som ges har väldigt stora konfidensintervall som växer för låg sannolikhet. Om tröskeln sätts för låg är det inte extremvattenstånd som utvärderas.

    Som en följd av denna analys bestämdes att andra metoder behöver tas fram för att studera de högsta havsvattenstånden längs Sveriges kust. I Schöld m.fl. (2017) redovisas hur man kan gå till väga för att ta fram högsta beräknade havsvattenstånd utifrån befintliga data.

  • 29.
    Karttjänst för framtida medelvattenstånd längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Havsnivån stiger och orsaken är den globala uppvärmningen. Effekterna av uppvärmningen på havets nivå kommer främst från den termiska expansionen samt bidrag från smältande glaciärer och de stora landisarna på Grönland och Antarktis.

    Hur snabbt den globala havsnivån stiger beror på hur stora utsläppen av växthusgaser blir. Globala medelvattenstånd fram till år 2100 har framtagits inom IPCC och beskrivs utifrån klimatscenarier, som innebär olika antaganden om den framtida utvecklingen. Oavsett klimatscenario stiger havsnivån och den kommer att fortsätta stiga även efter år 2100. Störst osäkerhet råder, angående framtida havsnivåer, kring avsmältningen av de stora ismassorna på Grönland och Antarktis.

    Medelvattenståndet är den nivå som avgör var strandlinjen normalt ligger och som höga och låga vattenstånd varierar kring. Medelvattenståndet längs Sveriges kuster kommer att förändras olika mycket, främst beroende på den pågående landhöjningen. Andra regionala processer som kan påverka medelvattenståndet är dåligt kända men bedöms i nuläget vara små.

    Globala medelvattenstånd, framtagna inom IPCC AR5, i kombination med landhöjningsinformation från Lantmäteriet har använts för att göra beräkningar av framtida medelvattenstånd längs svenska kusten. Beräkningarna sträcker sig till år 2100. Medelvattenstånd vid observationsplatser längs kusten för referensperioden 1986-2005 används som utgångsvärde.

    Resultaten har publicerats i en karttjänst som visar medelvattenståndet enligt tre olika utsläppsscenarier kring år 2050 respektive år 2100. Karttjänsten ger indikationer för vilka områden som kan vara sårbara för stigande havsnivåer.

  • 30.
    Nerheim, Signild
    et al.
    SMHI, Affärsverksamhet.
    Schöld, Sofie
    SMHI, Samhälle och säkerhet.
    Persson, Gunn
    SMHI, Affärsverksamhet.
    Sjöström, Åsa
    SMHI, Samhälle och säkerhet.
    Framtida havsnivåer i Sverige2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Sveriges kustområden drabbas ibland av tillfälliga översvämningar i samband med stormar eller då kraftiga lågtryck passerar. Översvämningar kan orsaka allvarliga samhällsstörningar och vatteninträngning i byggnader kan ge upphov till stora kostnader. Den pågående globala uppvärmningen, med stigande havsnivåer som följd, aktualiserar frågan om hur vattenståndet kring svenska kusten kan förändras, idag och i framtiden. Havet stiger och det kommer att pågå under hundratals eller kanske till och med tusentals år framöver.

    SMHI startade 2015 ett projekt för att beskriva havsnivåer längs svenska kusten i dagens och framtidens klimat. Projektet har levererat:

    • Beräknade medelvattenstånd för hela Sveriges kust för år 2050 och år 2100 utifrån tre olika framtida klimatscenarier.
    • En visningstjänst för framtida medelvattenstånd.
    • En beskrivning av hur höga havsvattenstånd kan beräknas för en specifik plats.
    • Höga vattenstånd för SMHI:s mätstationer samt en visualisering av dessa.
    • En översikt över statistisk metodik.
    • En vägledning för utvärdering av lokala effekter.
    • En beskrivning av kända högvattenhändelser i olika kustområden och parametrar och processer relaterade till dessa.

    Denna rapport presenterar en översikt över resultaten som tagits fram i projektet och avslutas med en beskrivning av hur framtidens höga havsnivåer kan bedömas i planeringssyfte. SMHI har i rapporten inte tagit ställning till vilket klimatscenario eller vilken tidshorisont som är mest lämpligt att använda för samhällsplanering. Detta måste bestämmas i ett situationsspecifikt sammanhang där risk och kostnader beaktas. SMHI vill betona att även om år 2100 ofta anges som slutår för klimatscenarier, så kommer havets nivå att fortsätta att stiga längre än så.

    Rapporten summerar resultat från övriga rapporter som framtagits inom projektet. För ytterligare detaljer hänvisas till dessa (se Förord).

  • 31.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Hellström, Sverker
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Kållberg, Per
    SMHI, Forskningsavdelningen, Meteorologi.
    Lindow, Helma
    SMHI, Samhälle och säkerhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Schimanke, Semjon
    SMHI, Forskningsavdelningen, Oceanografi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Vattenståndsdynamik längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    För att skapa ett samhälle väl anpassat till dagens och framtidens havsnivåer behövs besluts- och planeringsunderlag. Skyddsåtgärder och designnivåer för kustskydd är högaktuella frågor och många aktörer är intresserade av information kring potentiella maxnivåer för vattenstånd på olika tidshorisonter. SMHI har därför analyserat de mätdataserier för havsvattenstånd som idag finns tillgängliga från stationer längs Sveriges kust. Det primära syftet var att ta fram en metod för att beräkna det högsta möjliga havsvattenståndet vid mätstationer längs Sveriges kust. Metoden beskrivs i Schöld m.fl.(2017).

    I föreliggande rapport beskrivs allmänt havsnivåer, mätdata, modeller och de resultat som erhölls från olika analyser av mätdata. Mätstationerna indelades i åtta olika kustområden inom vilka vattenståndet samvarierar. Det väder och de specifika stormbanor, som under de senaste 40 åren orsakat de högsta stormfloderna på olika platser längs den svenska kusten kartlades, och vattenståndsdynamiken vid olika mätstationer studerades.

    Kortvariga höjningar av vattenståndet undersöktes, både med avseende på kraftiga vattenståndshöjningar orsakade av passerande väderssystem och med avseende på förhöjda utgångslägen, som i sin tur kan bidra till att stormfloder blir extra höga.

    Det högsta beräknade havsvattenstånd som presenteras är de högsta möjliga stormfloder som skulle kunna inträffa baserat på empiriska analyser av mätdata vid de olika stationerna. Kända extrema händelser, som ägt rum före det att vattenståndet började registreras, ingår inte eftersom de inte har kunnat kvantifieras. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport.

    Resultaten från studien visar att vattennivåerna i Östersjön generellt blir som högst i Bottenviken och i de södra delarna. De höga vattenstånden i större delen av Östersjön är inte lika höga som på västkusten och i Öresund. I Östersjön förefaller också utgångsläget, havsnivån före stormen, utgöra en större del av den resulterande vattenståndshöjningen. Vid flera stationer i de centrala delarna av Östersjön är havsnivån före storm i stort sett hälften av det högsta beräknade havsvattenståndet. Längs västkusten är istället de nettohöjningar som orsakas av rena stormeffekter den viktigaste stormflodskomponenten. Lokala förhållanden, till exempel om stationen är belägen vid en öppen, rak kust eller inne i en vik, påverkar hur högt vattenståndet kan förväntas bli på en viss plats.

    Analyserna visar att stormfloder skulle kunna bli omkring 20-40 cm högre än hittills observerade maximala nivåer i olika kustområden. En osäkerhetsmarginal på runt +15 cm är lämplig att addera, särskilt i de områden där tidvatten förekommer.

  • 32.
    Johansson, Lasse
    et al.
    SMHI, Affärsverksamhet.
    Gyllenram, Walter
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Lokala effekter på extrema havsvattenstånd2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    När havsvattennivån ska beräknas för en viss plats behöver hänsyn tas till lokala förhållanden. Vattenståndet lokalt kan avvika från det som observeras vid en av SMHI:s eller andras mätplatser. Geografin på platsen och vågor kan leda till högre vattennivåer än de som observeras vid mätplatserna.

    Denna rapport ger en kort beskrivning av hur vattenståndet längs Sveriges kuster byggs upp. Vi ger exempel på olika mekanismer för att läsaren ska få en uppfattning om skalorna i tid och höjd. Vågfenomen lokalt kan leda till att ytterligare högre nivåer kan beröras av vatten än vad vattenståndet anger.

    En översiktlig beskrivning görs av hur vågor interagerar med stränder ochkajer. Begreppen våguppstuvning och våguppsköljning förklaras. Några exempel ges på vilken effekt bottens lutning har och hur vågor utvecklas i hamnar.

    För att beräkna återkomstvärden för vattenstånd på en lokal plats beskrivs hur man kan utgå från de mätningar som SMHI gör sedan många år. Observationer från den närmaste eller de närmaste mätplatserna kan användas för att beräkna vattenstånd med olika återkomsttider för den önskade platsen. Ett exempel på en sådan beräkning presenteras där speciellt viktiga detaljer redovisas.

  • 33.
    Viktorsson, Lena
    et al.
    SMHI, Samhälle och säkerhet.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Revidering av fysikaliska och kemiskabedömningsgrunder i kustvatten: Underlag inför uppdatering av HVMFS 2013:192018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Detta är ett underlag för revidering av bilaga 5 i HVMFS 2013:19, Bedömningsgrunder för fysikaliskkemiskakvalitetsfaktorer i kustvatten och vatten i övergångszonen. Underlaget innefattar främst enuppdatering av referensvärden för näringsämnen samt förslag på uppdatering av viss text i föreskriftengällande syrebalans och siktdjup. Den generella metoden för var och en av stödparametrarna ibedömningsgrunderna bibehålls. I rapportens sista kapitel presenteras de uppdateringar av föreskriftenHVMFS 2013:19 som rekommenderas utifrån detta uppdrag.Efter en jämförelse av tidigare framtagna referensvärden för näringsämnen och de som tagits fram iden här rapporten rekommenderas att nya referensvärden i tillrinnande sötvatten används men atttidigare referensvärden för TN och TP vid utsjösalthalt samt att klassgränser behålls. En mindrejustering av referensvärden för DIN och DIP utifrån havsmiljöförordningens G/M värden föreslåsdock. De nya referensvärdena är framtagna med modellen S-HYPE (Lindström m.fl. 2010) förtillrinnande sötvatten och utifrån utsjövärden för oorganiskt fosfor och kväve (HVMFS 2012:18) samteffektsamband i mätdata. Det förtydligas också att ett konstant referensvärde för näringsämnenanvänds vid salthalter ≤2 psu.Den S-HYPE körning som använts för referensvärden i tillrinnande sötvatten är en bakgrundskörningsom är anpassad till definitionen av bakgrundsbelastning i PLC6 (Pollution Load Compilation 6,HELCOM).Utöver uppdatering av referensvärden för näringsämnen så föreslås en förändrad sammanvägning avkväve och fosfor i bedömningsgrunden. Det innebär att de ingående parametrarna för kväve och fosforsammanvägs var för sig. Bedömningsgrunderna ger då en separat status för varje näringsämne (kväveoch fosfor) baserat på de ingående parametrarna. Detta ger både en större möjlighet till att se vilketnäringsämne som bidrar till att eventuellt sänka status och stämmer överens med hur rapporteringentill EU-kommissionen ska ske.För syre rekommenderas en uppdatering om vilka mätmetoder som får användas, så att ävenmätningar med sensorer kan användas för statusbedömning. För siktdjup var ambitionen att ta fram etthumusgränsvärde för när kvalitetsfaktorn inte ska tillämpas. En fullständig statistisk analys har intehunnits med och en tydlig rekommendation kan inte ges.Det har under arbetet med att ta fram nya referensvärden för näringsämnen enligt nuvarande metodblivit tydligt att metoden för att bedöma näringsämnen behöver en mer övergripande uppdatering. Tillexempel kan metoden för salthaltskorrektion troligen förbättras med hjälp av en analys av mätdata ikombination med kustzonsmodellen.

  • 34.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Beräkning av högsta vattenstånd längs Sveriges kust2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I rapporten redovisas hur en metod framtagits för att kunna skatta de allra högsta havsvattenstånd som kan uppträda vid de mätstationer för havsvattenstånd som finns längs Sveriges kust. Metoden är generell och principerna kan därför tillämpas på mätdataserier från olika platser. För att kunna tillämpa metoden måste dock mätdataserien ha en viss minimilängd och tidsupplösning. Resultaten som tas fram är empiriska, vilket betyder att de baseras på tillgängliga mätdata.

    I analysen delades data upp i två delar; det genomsnittliga vattenståndet före en högvattenhändelse och nettohöjningen under en högvattenhändelse. Dessa delar benämns havsnivå före storm respektive nettohöjning, i enlighet med:

    stormflod = havsnivå före storm + nettohöjning

    Nivån på stormfloden är det högsta uppmätta havsvattenståndet under respektive högvattenhändelse. I analysen har även högvattenhändelser som inte förknippas med stormar inkluderats. Många av de högsta stormfloderna har inträffat när havsnivån före storm är förhöjd jämfört med medelvattenståndet, framförallt i stora delar av Östersjön. I analysen ingår samtliga högvattenhändelser från vilka det finns tillgänglig mätdata, även sådana som startat från ett lågt utgångsläge.

    I analysen indelades mätstationerna i olika kustområden och samvariationen mellan mätstationerna undersöktes. För varje enskild station, där havsvattenstånd observeras, har högsta havsnivå före storm och högsta nettohöjning framtagits. Den högsta havsnivån före storm som uppmätts inom kustområdet bedömdes gälla för alla mätstationer inom området. Det högsta beräknade havsvattenståndet definierades som kustområdets högsta havsnivå före storm plus mätstationens högsta nettohöjning.

    Tidvatteneffekten har inte beaktats särskilt, utan är i viss mån inkluderad i nettohöjningen. Denna förenkling beskrivs närmare i Schöld m fl. (2017).

    Analysen visade att:

    • samvariationen inom kustområden är mycket hög för vanligt förekommande vattenstånd.
    • högvattenhändelser förekommer oftare i vissa kustområden.
    • de högsta vattenstånden kan variera mycket, även mellan stationer inom samma kustområde.
    • havsnivån före storm är en mer betydande stormflodskomponent i Östersjön och mindre betydande i Skagerrak-Kattegatt.
    • havsnivån före storm behöver identifieras så att den inte är påverkad av själva stormhändelsen.
    • det är lämpligt att uppdatera det högsta beräknade havsvattenståndet regelbundet,särskilt efter att nya rekordhöga stormfloder inträffat.

    Vi valde att definiera havsnivån före storm som ett medelvärde över sju dygn, 48 timmar före stormflodens maximum. Metodiken avser nivåer ovanpå ett gällande medelvattenstånd. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport. Tillämpningen av metoden i ett framtida klimat beskrivs i Nerheim m fl. (2017).

  • 35.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2018Rapport (Övrigt vetenskapligt)
  • 36.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden.: Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra störstasjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren ärmycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är detVänern som har de största problemen i dagens klimat och fram till slutet av detta sekel,medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längretidsperspektiv.Klimatförändringarna medför bland annat förändrade vattennivåer, förändradevattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilketger konsekvenser för olika intressen runt sjöarna.En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte ärtydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är etthinder för att komma vidare med de problem som idag finns för Vänern och för denlångsiktiga klimatanpassningen av Mälaren, bortom detta sekel.Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring: Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vattenoch kortare perioder med is. Modellering av hur råvattenkvaliteten förändras i framtiden. Mer observationer för att fånga upp klimateffekter i sjöarna.Till varje sjö har en referensgrupp bestående av representanter för olika intressen kringsjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inomramen för projektet och frågeställningar som kommit upp under möten medreferensgrupperna, men även befintlig litteratur har använts.

  • 37. Fagerli, Hilde
    et al.
    Tsyro, Svetlana
    Rolstad Denby, Bruce
    Nyíri, Ágnes
    Gauss,, Michael
    Simpson, David
    Wind,, Peter
    Benedictow, Anna
    Jonson, Jan Eiof
    Klein, Heiko
    Schulz, Michael
    Griesfeller, Jan
    Aas, Wenche
    Hjellbrekke, Anne-Gunn
    Solberg, Sverre
    Matthew Platt, Stephen
    Fiebig, Markus
    Yttri, Karl Espen
    Rud, Richard Olav
    Tørseth, Kjetil
    Mareckova, Katarina
    Pinterits, Marion
    Tista, Melanie
    Ullrich, Bernhard
    Wankmüller, Robert
    Posch, Maximilian
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Imhof, Hannah
    Cruz Minguillón, Maria
    Putaud, Jean-Philippe
    Cavalli, Fabrizia
    Poulain, Laurent
    Schlag, Patrick
    Heikkinen, Liine M.
    Swietlicki, Erik
    Martinsson, Johan
    Vana, Milan
    Holubova Smejkalova, Adeala
    Kouvarakis,, Giorgos
    Mihalopoulos, Nikos
    Transboundary particulate matter, photo-oxidants, acidifying and eutrophying components: EMEP Status Report 1 2017; August 23, 20172017Rapport (Övrigt vetenskapligt)
    Abstract [en]

    This report presents the EMEP activities in 2016 and 2017 in relation to transboundary fluxes of particulate matter, photo-oxidants, acidifying and eutrophying components, with focus on results for 2015. It presents major results of the activities related to emission inventories, observations and modelling. The report also introduces specific relevant research activities addressing EMEP key challenges, as well as technical developments of the observation and modelling capacities. An important topic this year is the transition to the new EMEP grid and resolution. For the first time, officially reported fine scale emissions (0.1◦×0.1◦ resolution) have been used in the EMEP MSC-W model runs for air pollution assessment. The impacts of this change on model results and its comparisons to observations are analyzed in this report.

  • 38.
    Eilola, Kari
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Lindqvist, Stina
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Wåhlstrom, Irene
    SMHI, Forskningsavdelningen, Oceanografi.
    Bartoli, Marco
    Klaipeda University, Lithuania.
    Burska, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Carstensen, Jacob
    Aarhus University, Denmark.
    Hellemann, Dana
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hietanen, Susanna
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hulth, Stefan
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Janas, Urszula
    Institute of Oceanography, University of Gdansk, Poland.
    Kendzierska, Halina
    Institute of Oceanography, University of Gdansk, Poland.
    Pryputniewicz-Flis, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Voss, Maren
    Leibniz Institute for Baltic Sea Research Warnemünde, Germany.
    Zilius, Mindaugas
    Klaipeda University, Lithuania.
    Linking process rates with modellingdata and ecosystem characteristics2017Rapport (Refereegranskat)
    Abstract [en]

    This report is related to the BONUS project “Nutrient Cocktails in COAstal zones of the Baltic Sea” alias COCOA. The aim of BONUS COCOA is to investigate physical, biogeochemical and biological processes in a combined and coordinated fashion to improve the understanding of the interaction of these processes on the removal of nutrients along the land-sea interface. The report is especially related to BONUS COCOA WP 6 in which the main objective is extrapolation of results from the BONUS COCOA learning sites to coastal sites around the Baltic Sea in general. Specific objectives of this deliverable (D6.4) were to connect observed process rates with modelling data and ecosystem characteristics.

    In the report we made statistical analyses of observations from BONUS COCOA study sites together with results from the Swedish Coastal zone Model (SCM). Eight structural variables (water depth, temperature, salinity, bottom water concentrations of oxygen, ammonium, nitrate and phosphate, as well as nitrogen content in sediment) were found common to both the experimentally determined and the model data sets. The observed process rate evaluated in this report was denitrification. In addition regressions were tested between observed denitrification rates and several structural variables (latitude, longitude, depth, light, temperature, salinity, grain class, porosity, loss of ignition, sediment organic carbon, total nitrogen content in the sediment,  sediment carbon/nitrogen-ratio, sediment chlorphyll-a as well as bottom water concentrations of oxygen, ammonium, nitrate, and dissolved inorganic  phosphorus and silicate) for pooled data from all learning sites.

    The statistical results showed that experimentally determined multivariate data set from the shallow, illuminated stations was mainly found to be similar to the multivariate data set produced by the SCM model. Generally, no strong correlations of simple relations between observed denitrification and available structural variables were found for data collected from all the learning sites. We found some non-significant correlation between denitrification rates and bottom water dissolved inorganic phosphorous and dissolved silica but the reason behind the correlations is not clear.

    We also developed and evaluated a theory to relate process rates to monitoring data and nutrient retention. The theoretical analysis included nutrient retention due to denitrification as well as burial of phosphorus and nitrogen. The theory of nutrient retention showed good correlations with model results. It was found that area-specific nitrogen and phosphorus retention capacity in a sub-basin depend much on mean water depth, water residence time, basin area and the mean nutrient concentrations in the active sediment layer and in the water column.

  • 39.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and  Development of an oxygen consumption  indicator2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten innehåller två delar vilka båda är fristående rapporter och ett bidrag till HELCOM-projektet EUTRO-OPER. Uppdraget har finansierats och beställts av Havs- och Vattenmyndigheten (HaV), 2014-2015.

    • Bedömning av övergödning i kustvatten med HEAT 1.0 (Vattendirektivets metodik) versus HEAT 3.0 (Havsmiljödirektivets metodik)

    Status för övergödning bedöms nationellt i kustnära områden i Vattendirektivet (VD) och i öppet hav inom Havsmiljödirektivet (HMD). Båda direktiven tar hänsyn till övergödning men med olika tillvägagångssätt och det finns därför ett behov av harmonisering i bedömningsprocessen. Det Excelbaserade verktyget HEAT (HELCOM Eutrophication Assessment Tool) har använts i tidigare bedömningar i HELCOM-regionen. Det finns två versioner; HEAT 1.0 och HEAT 3.0, den första är baserat på VD metodik och den andra är baserad på HMD metodik. Den största skillnaden mellan HEAT 1.0 och HEAT 3.0 är hur indikatorerna är grupperade. Här bedömer vi status för övergödning i kustvatten med HEAT och jämför resultaten med den nationella bedömningen inom VD. Detta test inkluderar data för 33 vattenförekomster i fem länder; Estland, Finland, Lettland, Polen och Sverige. Information om referensvärden, acceptabel avvikelse, status och klassgränser för alla indikatorer som används inom VD för att rapportera ekologisk status (biologisk och fysisk-kemisk) har tillhandahållits för varje testområde. Informationen har lagts in i HEAT 1.0 och HEAT 3.0 och jämförts med den nationella bedömningen inom VD. Båda HEAT-verktygen genererade lägre status i mer än 50 % av fallen. För en del fall ändrades status till sub-GES från GES när HEAT användes. Klassgränsen för god/måttlig status är densamma i HEAT och VD medan de lägre klassgränserna generellt är striktare i HEAT vilket förklarar den lägre statusen. I nationella bedömningar inom VD används expertbedömning i de fall där in situ data är bristfällig, saknas eller har hög osäkerhet. Statusen i HEAT ges av en-ut-alla-ut principen men det är ändå möjligt att inkludera expertbedömning genom viktningsprocessen.

    • Utveckling av en syreindikator

    Det undersöktes om syrekonsumption kan användas som en syreindikator för Östersjön. Metoden är baserad på idén att beräkna syrekonsumptionen i ett stabilt lager under den produktiva zonen sommartid och relatera den till närsaltskoncentrationer. Med mer närsalter tillgängliga ökar den biologiska produktionen. Genom att uppskatta hur mycket syre som behövs för att bryta ned det biologiska materialet borde det vara möjligt att koppla syrekonsumption till övergödning. Syrekonsumptionen beräknades för BY15-Gotlandsdjupet i östra Gotlandsbassängen. Vi identifierade ett stabilt lager mellan 30 och 50 meter och en stor förändring i syre och närsalter från juni till augusti. Syrekonsumptionen hade stora variationer mellan år och det fanns ingen signifikant korrelation till vintermedel av närsalter. Det var inte möjligt att beräkna diffusionen på grund av för glesa mätningar kring skiktningen, detta begränsar metoden. Det är däremot möjligt att förbättra uppskattningen av diffusionen med en modell. Djupet av det stabila lagret varierar mellan områden och även mellan år vilket kräver en del handpåläggning för metoden. Vi insåg att metoden har för många begränsningar för att vara en funktionell indikator. En funktionell indikator ska inte vara beroende av krävande modellering eller för mycket handpåläggning. Vi undersökte också om en möjlig kandidat till en lite enklare syrekonsumptionindikator skulle kunna vara att beräkna syremättnaden på en specifik nivå. Om vi antar att temperaturen inte har ändrats så mycket sedan skiktningen etablerades kan vi förvänta oss att förändringen i syremättnad i augusti beror på biologisk syrekonsumption under sen vår och sommar. Korrelationen med vinternärsalter förbättrades något i detta fall. 

  • 40.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and Development of an oxygen consumption indicator2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Den här rapporten innehåller två delar vilka båda är fristående rapporter och ett bidrag till HELCOM-projektet EUTRO-OPER. Uppdraget har finansierats och beställts av Havs- och Vattenmyndigheten (HaV), 2014-2015.

    • Bedömning av övergödning i kustvatten med HEAT 1.0 (Vattendirektivets metodik) versus HEAT 3.0 (Havsmiljödirektivets metodik)

    Status för övergödning bedöms nationellt i kustnära områden in Vattendirektivet (VD) och i öppet hav inom Havsmiljödirektivet (HMD). Båda direktiven tar hänsyn till övergödning men med olika tillvägagångssätt och det finns därför ett behov av harmonisering i bedömningsprocessen. Det Excelbaserade verktyget HEAT (HELCOM Eutrophication Assessment Tool) har använts i tidigare bedömningar i HELCOM-regionen. Det finns två versioner; HEAT 1.0 och HEAT 3.0, den första är baserat på VD metodik och den andra är baserad på HMD metodik. Den största skillnaden mellan HEAT 1.0 och HEAT 3.0 är hur indikatorerna är grupperade. Här bedömer vi status för övergödning i kustvatten med HEAT och jämför resultaten med den nationella bedömningen inom VD. Detta test inkluderar data för 33 vattenförekomster i fem länder; Estland, Finland, Lettland, Polen och Sverige. Information om referensvärden, acceptabel avvikelse, status och klassgränser för alla indikatorer som används inom VD för att rapportera ekologisk status (biologisk och fysisk-kemisk) har tillhandahållits för varje testområde. Informationen har lagts in i HEAT 1.0 och HEAT 3.0 och jämförts med den nationella bedömningen inom VD. Båda HEAT-verktygen genererade lägre status i mer än 50 % av fallen. För en del fall ändrades status till sub-GES från GES när HEAT användes. Klassgränsen för god/måttlig status är densamma i HEAT och VD medan de lägre klassgränserna generellt är striktare i HEAT vilket förklarar den lägre statusen. I nationella bedömningar inom VD används expertbedömning i de fall där in situ data är bristfällig, saknas eller har hög osäkerhet. Statusen i HEAT ges av en-ut-alla-ut principen men det är ändå möjligt att inkludera expertbedömning genom viktningsprocessen.

    • Utveckling av en syreindikator

    Det undersöktes om syrekonsumption kan användas som en syreindikator för Östersjön. Metoden är baserad på idén att beräkna syrekonsumptionen i ett stabilt lager under den produktiva zonen sommartid och relatera den till närsaltskoncentrationer. Med mer närsalter tillgängliga ökar den biologiska produktionen. Genom att uppskatta hur mycket syre som behövs för att bryta ned det biologiska materialet borde det vara möjligt att koppla syrekonsumption till övergödning.

    Syrekonsumptionen beräknades för BY15-Gotlandsdjupet i östra Gotlandsbassängen. Vi identifierade ett stabilt lager mellan 30 och 50 meter och en stor förändring i syre och närsalter från juni till augusti. Syrekonsumptionen hade stora variationer mellan år och det fanns ingen signifikant korrelation till vintermedel av närsalter. Det var inte möjligt att beräkna diffusionen på grund av för glesa mätningar kring skiktningen, detta begränsar metoden. Det är däremot möjligt att förbättra uppskattningen av diffusionen med en modell. Djupet av det stabila lagret varierar mellan områden och även mellan år vilket kräver en del handpåläggning för metoden. Vi insåg att metoden har för många begränsningar för att vara en funktionell indikator. En funktionell indikator ska inte vara beroende av krävande modellering eller för mycket handpåläggning. Vi undersökte också om en möjlig kandidat till en lite enklare syrekonsumptionindikator skulle kunna vara att beräkna syremättnaden på en specifik nivå. Om vi antar att temperaturen inte har ändrats så mycket sedan skiktningen etablerades kan vi förvänta oss att förändringen i syremättnad i augusti beror på biologisk syrekonsumption under sen vår och sommar. Korrelationen med vinternärsalter förbättrades något i detta fall. 

  • 41.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Fölster, Jens
    Drakare, Stina
    Sonesten, Lars
    Förslag till plan för revidering av fysikalisk-kemiska bedömningsgrunder för ekologisk status i sjöar, vattendrag och kustvatten Del A: SJÖAR OCH VATTENDRAG (SLU) Del B: KUSTVATTEN (SMHI)2017Rapport (Övrigt vetenskapligt)
  • 42.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Axe, Philip
    SMHI, Forskningsavdelningen, Oceanografi.
    Johansson, Johannes
    SMHI, Samhälle och säkerhet.
    Linders, Johanna
    SMHI, Samhälle och säkerhet.
    Nexelius, Nils
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    Swedish National Report on Eutrophication Status in the Skagerrak, Kattegat and the Sound - OSPAR ASSESSMENT 20162017Rapport (Övrigt vetenskapligt)
    Abstract [en]

    The Swedish OSPAR waters were assessed by applying the OSPAR Common Procedure for the time period 2006 – 2014. The Swedish parts of Skagerrak, Kattegat and the Sound constitute the outer part of the transition zone between the estuarine Baltic Sea and the oceanic North Sea and were investigated for nutrients, chlorophyll-a,oxygen, macrophytes, phytoplankton and zoobenthos. The conclusion from the overall assessment of the Swedish OSPAR waters was that only Skagerrak open sea could be classified as a Non-Problem Area and all other assessment units were classified as Problem Areas.  Atmospheric input of nitrogen significantly decreased in both Skagerrak and Kattegat and the land based input of total nutrients also decreased in Skagerrak, Kattegat as well as the Sound. However, the short-term trend of nitrogen input to the Sound was positive. Skagerrak is governed by trans-boundary transports from the North Sea of mainly nitrogen but also phosphorus. Kattegat receives trans-boundary nutrients from both the Baltic Sea through the Sound and from Skagerrak and transports nutrients towards the coast and the western part of the basin.  Overall, concentrations of DIN, DIP, TN and chlorophyll-a decreased in most areas, however, no significant trends were found for DIP. Increasing concentrations were found in silicate, POC and TP. The Secchi depth increased in most areas. Oxygen deficiency was mainly a problem in the fjords and the Kattegat open sea.  In Skagerrak coastal waters winter nutrients were only elevated in the fjords. Concentrations of DIN generally decreased significantly and there were tendencies of decreasing DIP. This pattern was also supported by the total nitrogen while total phosphorus increased. Secchi depth was improving and there was a significant positive trend of increasing depths. However, zoobenthos were still in bad condition and phytoplankton indicator species were often elevated. Chlorophyll-a concentrations were generally decreasing but still elevated in the inner coastal waters. There were also problems with algal toxins such as DST (Diarrhetic Shellfish Toxin) and PST (Paralystic Shellfish Toxin) infections in the area. According to the OSPAR classification scheme, a unit with no evident increased nutrient enrichment can be classified as a Problem Area but the cause might be due to trans-boundary transport from adjacent areas. In the open area of Kattegat there were still problems with oxygen deficiency, especially in the southern parts, even though the trend was significantly positive for the assessment period 2006 – 2014. Concentrations of chlorophyll-a and DIN decreased significantly, however, DIN levels were still generally elevated, especially in the southern parts of Kattegat while DIP was closer to the assessment level. In Kattegat coastal waters winter nutrients were elevated in all assessment units, except from the inner coastal waters, even though there was a general pattern of decreasing going trends. Chlorophyll-a was mainly elevated in the Sound and the estuaries. Secchi depth is generally improving and a significant increase was seen in the Sound. Also in Kattegat, zoobenthos were in bad condition and phytoplankton indicator species were often elevated. 

  • 43.
    Andersson, Pia
    et al.
    SMHI, Samhälle och säkerhet.
    Hansson, Martin
    SMHI, Samhälle och säkerhet.
    Bjurström, Joel
    Simonsson, Daniel
    Naturtypsbestämning av miljöövervakningsstationer SMHI pelagial miljöövervakning2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Provtagningsstationerna i den nationella miljöövervakningen i havsmiljö är inte naturtypsbestämda. Detta innebär att insamlad miljöövervakningsdata inte kan användas fullt ut till bedömningar för artikel 17, art- och habitatdirektivet, samt för havsmiljödirektivet.  HaV har finansierat och uppdragit åt SMHI att undersöka möjligheterna att på ett enkelt sätt naturtypsklassa de månatliga miljöövervakningsstationerna som SMHI provtar. Uppdraget avsåg att testa utrustning och med hjälp av dropvideo undersöka om det är möjligt att, och i så fall, naturtypsbestämma stationer i utsjön under decemberexpeditionen 2016.  SMHI har konstruerat en rigg och utfört provtagning på 11 av 25 miljöövervakningsstationer. Belysningsproblematik och väder reducerade antalet provtagna stationer. SMHI anser att riggen, med justerad ljuskälla, är ett bra verktyg för visuell registrering av naturtyp på miljöövervakningsstationerna i utsjön.  Dock föreslås ett antal justeringar av riggen för att öka kvalitén på bildmaterialet samt att öka möjligheten att utföra ytterligare bedömningar av bildmaterialet.  Merparten av de undersökta bottnarna visar på väldigt finkornigt materiel, likt silt/lera. Ett fåtal arter har registrerats och ingen större mängd växtlighet. Merparten av de undersökta stationerna uppfyllde inte kriteriet för någon av habitatdirektivets naturtyper. På två stationer har naturtyp registreras som 1160 Vikar och sund, innehållandes1110 Sandbankar. För HUB Underwater biotopes har AB.H3O Baltic aphotic muddy sediment characterized by infaunal echinoderms registrerats på stationen P2 och AB.M4U Baltic aphotic mixed substrate characterized by no macrocommunity på stationerna BY5 och BY4.  SMHI rekommenderar en genomgång av det insamlade materialet med ArtDatabanken och/eller ytterligare expert för att säkerställa bedömning, utföra vissa rekommendationer samt säkerställa material som ska rapporteras till datavärd.SMHI rekommenderar ytterligare visuell provtagning på resterande stationer, samt kompletterande provtagning på stationer där kvalité på bild eller ljus varit bristfällig, eller där ArtDatabanken eller möjlig ytterligare expert rekommenderar ytterligare provtagning. Ytterligare expert kan komma att rekommendera hugg som kompletterande provtagning till den visuella metoden.En visuell undersökning på samtliga 25 stationer, med en landning per station, uppskattas förlänga en expedition med ca 11,5-13,5 timmar. 

  • 44.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Summary of the Swedish National Marine Monitoring 2016 - Hydrography, nutrients and phytoplankton2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Resultat från Sveriges nationella samlade nationella marina övervakning i den fria vattenmassan under året 2016 presenteras. De nationella utförarna är Sveriges metrorologiska och hydrologiska institut (SMHI), Stockholms Universitet (SU) och Umeå marina forskningscentrum (UMF). De parametrar som presenteras i rapporten är salthalt, temperatur, syre, löst oorganiskt fosfor, totalfosfor, löst oorganiskt kväve, totalkväve, löst kisel, klorofyll och växtplankton. Även siktdjup, djurplankton, humus, primär produktion, pH och alkalinitet provtas men de presenteras inte. Säsongsfigurer tillsammans med statistik presenteras för ytvatten i Bilaga I. Tidsserier för ytvatten (0-10 m) och bottenvatten presenteras i Bilaga II. Mängden närsalter i Östersjöns delbassänger under vintern presenteras i bilaga III.Speciella händelser 2016

    • Flertalet högtryckspassager orsakade en ovanligt varm septembermånad, vilket gav yttemperaturer mer än en standard avvikelse över det normala vid nästa alla stationer i Skagerrak, Kattegatt och Östersjön.
    • I Kattegatts bottenvatten var det mycket låga syrgashalter under hösten men förhållandena återgick till det normala under vintern. Detta syns framförallt i säsongsfigurerna för Anholt E och Fladen.
    • Syresituationen i Östra Gotlandsbassängen har förbättrats något och anledningen är att antalet inflöden har blivit fler sedan det senaste stora inflödet som skedde i december 2014. Inflödet på 30 km3 i början av året kunde senare under juni spåras i bottenvattnet i Östra Gotlandsbassängen. 
    • Nivåerna av kisel i Östersjön har under de senaste åren varit över det normala och så även detta år men främst i de centrala och norra delarna av Egentliga Östersjön.
    • I juli noterades förhållandevis stora mängder av dinoflagellaten Dinophysis acuminata. Detta orsakade förhöjda halter av Dinophysis-toxiner i blåmusslor vilket i sin tur ledde till att Livsmedelsverket förbjöd musselskörd i vissa områden längs Bohuskusten.
    • Ovanligt lång blomning av cyanobakterier i Östersjön.
  • 45.
    Wåhlström, Irene
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eilola, Kari
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Evaluation of open sea boundary conditions for the coastal zone. A model study in the northern part of the Baltic Proper.2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Miljötillståndet i Sveriges kustvatten är starkt kopplat till tillståndet i det öppna havet på grund av det stora vattenutbytet mellan dessa. Det är därför viktigt att modeller utvecklade för kustzonens vatten har drivning från utsjön av god kvalitet med bra täckning i tid och rum samt med information om de variabler som krävs.

    För att beräkna vattenkvalitén i kustnära vatten har SMHI utvecklat en modell kallad kustzonsmodellen (SCM). Den drivs för närvarande från öppna havet av resultatfiler från en en-dimensionell modell som med hjälp av observationer har korrigerat och förbättrat modellresultaten. Tyvärr är dessa observationer undermåliga i tid och rum, och saknar nödvändiga variabler för att få bra drivning av SCM modellen. Dessa mätstationer ligger också längre ut i öppna havet och kan därför underskatta variabiliteten närmare kusten för de olika parametrarna. Dessa problem löses delvis med den en-dimensionella modellen som beräknar alla de variabler som är nödvändiga i SCM. Dock är dessa resultat inte användbara om man vill undersöka en historisk period eller framtida klimatförändringar i kustzonen. På grund av dessa tillkortakommanden undersöker vi i denna studie om det är möjligt att istället ersätta dagens drivning från öppna havet med resultat från en tre-dimensionell, kopplad fysisk och biogeokemisk modell för Östersjön som drivning för SCM, framförallt för att undersöka de två ovan nämnda perioder.

    I denna studie har sju känslighetsexperiment utförts i en pilotstudie för Norra Östersjön, inklusive Stockholms skärgård. De sju känslighetsexperimenten utfördes för att utvärdera olika metoder att extrahera resultat-filer från den tre-dimensionella modellen RCO-SCOBI med avsikt att användas som drivning för SCM. RCO-SCOBI är en modell för Östersjön med hög horisontell och vertikal upplösning av de variabler som krävs. Resultaten för både de fysiska och biogeokemiska processerna från de olika testen undersöktes och utvärderades mot observationer i kustzonen med hjälp av en statistisk metod.

    Slutsaten från dessa test är att resultatfiler från RCO-SCOBI är tillämpbara som utsjödrivning för SCM. Den bästa metoden är att extrahera en djupprofil per variabel för varje ytterbassäng i SCM i en punkt 10 nautiska mil österut och 10 nautiska mil söderut i egentliga Östersjön eller norrut i Bottenhavet för varje ytterbassäng i SCM.

  • 46.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Denna rapport presenterar hur vattentemperatur och is beräknas förändras i Mälaren tillmitten av seklet och fram till 2100 på grund av den globala uppvärmningen.Beräkningarna är gjorda med en sjömodell där Mälaren är uppdelad i två bassänger. Dekallas västra Mälaren och östra Mälaren.De tydligaste förändringarna i Mälaren i ett framtida klimat beräknas bli högrevattentemperaturer både på ytan och på botten samt kortare period med is. Iberäkningarna har två framtidsscenarier använts, vilka baseras på mängden växthusgaser iatmosfären. I det högre scenariot, vilket motsvarar fortsatta utsläpp med dagensutsläppsnivåer, ökar vattentemperaturen mer jämfört med scenariot där utsläppen avväxthusgaser är begränsade.Sammanfattning av resultaten för klimatscenarierna: Den årliga perioden som Mälaren är täckt med is beräknas minska med enmånad till två månader mot slutet av seklet. Ytvattnets medeltemperatur beräknas öka 1,5 till 2,5 grader för bådabassängerna. Förändringen är ungefär lika stor under hela året. Bottenvattnets medeltemperatur väntas öka mellan 1 till 2 grader i den grundarevästra bassängen och 0,5 till 1,5 grader i den djupare östra bassängen.Förändringen är ungefär lika stor under hela året. Maxtemperaturen ökar något mer än medeltemperaturen för både ytvatten ochbottenvatten. Den period som ytvattnets dygnsmedeltemperatur är över 20 grader, ökar medcirka en månad upp till en och en halv månad.Medeltemperaturen och maxtemperaturen för dagens klimat är beräknad utifråntidsperioden 1997-2015 och utifrån 2032-2050 och 2080-2098 för ett framtida klimat.Maxtemperaturen är det högsta värdet som beräknas uppnås under perioden.

  • 47.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Harbman, Ulrika
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vänern. Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vänern fram till 2100 på grund av den globala uppvärmningen. De tydligaste förändringarna i Vänern och Göta älv i ett framtida klimat beräknas bli att:  Det blir vanligare med låga nivåer i Vänern.  Det blir vanligare med höga nivåer i Vänern.  Det blir vanligare med låga tappningar i Göta älv.  Det blir vanligare med höga tappningar i Göta älv.  Det blir högre vattentemperaturer.  Det blir kortare perioder med is. I denna rapport redovisas nya beräkningar för Vänerns nivåer som ersätter de tidigare beräkningarna från 2010 (Bergström m.fl. 2010).

  • 48.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vättern Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vättern fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Vättern i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • Det blir mindre vanligt med höga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta vattennivå) väntas bli oförändrade.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is.

    I ett varmare klimat beräknas avdunstningen öka, både från växtligheten i Vätterns tillrinningssområde och direkt från sjöns yta. Det gör att vattennivån i Vättern väntas ligga på en lägre nivå i framtiden. Enligt beräkningarna väntas medelvattennivån i Vättern minska med ca en till två decimeter till slutet av seklet, med ungefär lika stor minskning under alla årstider.Antal dagar per år med nivåer under sänkningsgränsen 88,3 m väntas öka från dagens ca 1,5 månad till ca 3 månader i mitten av seklet och 4-6 månader i slutet av seklet. De allra högsta nivåerna, beräknad högsta vattennivå, beräknas vara oförändrade i framtiden.Vattentemperaturen i Vätterns ytvatten väntas öka med ca en grad till mitten av seklet och ca 1,5 till 3 grader till slutet av seklet. Bottenvattnets temperatur väntas inte förändras till mitten av seklet men öka med upp till en grad i slutet av seklet.Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka en vecka per år till cirka två veckor i mitten av seklet och upp till 6 veckor i slutet av seklet. Antalet år då Vättern är islagd beräknas minska kraftigt till slutet av seklet.

  • 49.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    German, Jonas
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Hjälmaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Hjälmaren fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Hjälmaren i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta nivå) väntas öka något.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is

    Vattennivån i Hjälmaren väntas förändras måttligt i framtida klimat. Den tydligaste förändringen är att det vänas bli vanligare med låga nivåer, främst under sommar och höst. Detta är en följd av att avdunstningen, både från växtligheten i Hjälmarens avrinningsområde och direkt från sjön, beräknas öka i framtiden. I dagens klimat är vattennivån lägre än 21, 6 m (vilket motsvarar Hjälmarens sänkningsgräns) under i genomsnitt en månad per år. I framtiden väntas nivån vara lägre än 21,6 m under ca 3,5 månader.

    För de allra högsta nivåerna (beräknad högsta vattennivå) syns en ökning för det kraftigaste utsläppsscenariot (RCP8.5) medan förändringarna är små för scenariot med begränsade utsläpp av växthusgaser (RCP4.5).Vattentemperaturen i Hjälmaren väntas öka med cirka en halv grad till mitten av seklet och mellan 1 och 2,5 grader till slutet av seklet. Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka sju veckor per år till cirka 9 veckor i mitten av seklet och upp till 12 veckor i slutet av seklet. I dagens klimat är Hjälmaren islagd varje vinter. I framtida klimat väntas isläggningen utebli vissa vintrar.

  • 50.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Nylén, Linda
    SMHI, Affärsverksamhet.
    Berggreen-Clausen, Steve
    SMHI, Affärsverksamhet.
    Berg, Peter
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Rayner, David
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Från utsläppsscenarier till lokal nederbörd och översvämningsrisker2016Rapport (Övrigt vetenskapligt)
    Abstract [sv]

    Inom det av MSB finansierade projektet ”Nederbörd och översvämningar i ramtidens Sverige - ett system till stöd för klimatanpassning” har SMHI ansvarat för hydrologisk och hydraulisk modellering samt framtagande av tidsserier med lokalt klimat för framtida förhållanden. Två metoder att bearbeta klimatdata har använts; SMHI:s Distributionsbaserad skalering (DBS) och en statistisk metod utarbetad vid Göteborgs universitet.

1234567 1 - 50 av 709
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf
v. 2.35.9