Endre søk
Begrens søket
1234567 1 - 50 of 700
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
Treff pr side
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
Sortering
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
Merk
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 1.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    The Swedish National Marine Monitoring Programme 2018. Hydrography Nutrients Phytoplankton2019Rapport (Annet vitenskapelig)
    Abstract [en]

    This report presents the main results of the Swedish national marine monitoring programme of thepelagic during 2018. The monitoring data of hydrography, nutrients and phytoplankton are analysedfor the seas surrounding Sweden: the Skagerrak, the Kattegat, the Sound, the Baltic Proper, theBothnian Sea and the Bothnian Bay.The national environmental monitoring of the pelagic is carried out by SMHI (SwedishMeteorological and Hydrological Institute), Stockholm University and UMF (Umeå Marine SciencesCentre). Data is collected, analysed and reported with support from Swedish environmentalmonitoring and on behalf of by SwAM (Swedish Agency for Marine and Water Management). TheSMHI monitoring is made in cooperation between the national environmental monitoring of thepelagic and the SMHI oceanographic sampling programme for the seas surrounding Sweden and is cofinancedby SwAM and SMHI. This annual summary of the national monitoring is made by SMHI andis financed by the contract between SwAM and SMHI.The weather in 2018 was characterized by high air temperatures and a few storms that impliedconsequences for the state in the sea. The spring arrived quickly and the sea surface temperatureincreased rapidly from April to May. In August and September two storms, named Johanne and Knud,passed the region and the surface layer was well-mixed at several stations. At the East coast upwellingevents were noted in both the Baltic Proper and the Bothnian Sea.During the year there were two small deep water inflows to the Baltic Proper that temporarilyimproved the oxygen condition in the southern parts. No improvements of the oxygen condition wereseen in the Eastern and Western Gotland Basins, instead the amount of hydrogen sulphide increased inthese basins during the year.The spring bloom had arrived in the Skagerrak and the Kattegat in March and concentrations ofdissolved inorganic phosphorus (DIP) and dissolved inorganic nitrogen (DIN) were close to or at thedetection limit from April to September. In the Skagerrak and the Kattegat the spring bloom wasdominated by the diatom Skeletonema marinoi. In the Baltic Proper the spring bloom was observed amonth later, in April. The extensive cyanobacteria bloom in the Baltic Proper started already in Mayand during the late September cruise cyanobacteria were still abundant. The dinoflagellateProrocentrum compressum was found in high cell numbers during the autumn at all stations on theWest coast. This flagellate has rarely been observed previously and although it is not harmful it isinteresting when species suddenly occur and stay for a longer period. The potentially harmful diatomgenus Pseudo-nitzschia bloomed in the beginning of December.Surface concentrations of DIP and DIN were mainly normal except from in the Skagerrak and theKattegat where concentrations were lower than usual in December. Concentrations of silicate wereabove normal levels before the spring bloom at most of the stations and in the Baltic Proper silicatewas also high in the autumn.In 2018 there were some difficulties with available research vessels for the planned cruises and somecruises needed to be cancelled with short notice. Many planned observations were therefore missed, inparticular during the summer period.

  • 2.
    Algotsson, Josefina
    et al.
    SMHI, Samhälle och säkerhet.
    Van Der Stelt, Frank
    SMHI, Affärsverksamhet.
    Abdoush, Diala
    SMHI, Samhälle och säkerhet.
    Swedish coastal water bodies on Wikidata Combining WFD data with Wikidata2019Rapport (Annet vitenskapelig)
    Abstract [en]

    In accordance with the Water Framework Directive, the water district authorities report environmental information on Sweden’s surface water bodies to the EU.Under the government commission Smartare miljöinformation to the Swedish Environmental Protection Agency, Naturvårdsverket, the initiative was taken to adopt the reported environmental information on Sweden’s coastal water bodies to Wikidata and Wikipedia. SMHI has led the initiative with support from Wikimedia Sweden, the South Baltic Sea Water District Authority, the county administrative board of Jönköping and Wikimedia volunteers.The aim of this project has been to make the environmental information about Sweden’s coastal water bodies more accessible to the public, to disseminate knowledge about status classification and create conditions for increasing environmental awareness among the public. The project has resulted in:• 653 new coastal water bodies are described on Wikidata.• Wikipedia articles on water management in Sweden, coastal water bodies and the SVAR database have been created.• A template for infoboxes on Wikipedia has been developed and can automatically retrieve and display the status classification of coastal water bodies.• The template for infoboxes on coastal water bodies is used in articles on coastal waters on Wikipedia.• The license for the SVAR database is set to CC0, which facilitates the use of the information and opens the possibility of using it in more ways than before.

  • 3.
    Langner, Joakim
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord Wylde, Helene
    SMHI, Affärsverksamhet.
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    Mapping of phytotoxic ozone dose for birch, spruce, wheat and potato using the MATCH-Sweden system2019Rapport (Annet vitenskapelig)
    Abstract [sv]

    Vi har lagt till beräkningar av PODY för björk, gran vete och potatis i MATCHSverigesystemet. Rapporten går igenom de förändringar och uppdateringar som harinförts i beräkningarna sedan den ursprungliga implementeringen 2016.Resultat för receptorerna generic crops (POD3gen-CR), generic deciduous trees (POD1gen-DT), birch (POD1spec-birch), spruce (POD1spec-spruce), wheat (POD6spec-whet), potato (POD6specpotato),presenteras för åren 2013-2017.En jämförelse med resultat från EMEP-modellen för generic crops och för genericdeciduous trees ger en bättre överensstämmelse än tidigare. Givet att ett fel i beräkningenav solstrålningen har identifierats i EMEP-modellen så framstår resultaten från MATCHSverigeoch EMEP nu som mer konsistenta.Variationen från år till år i PODY för björk och gran är av samma storleksordning somden som beräknas för generic deciduous trees, men numeriska värden för PODY skiljersig, framför allt för björk beroende på skillnader i de parametrar som ingår i beräkningenoch på användning av längre vegetationsperioder baserade på svenska och skandinaviskadata. Kritiska nivåer motsvarande 4 % reduktion i tillväxten av björk och gran överskridsi stort sett i hela landet för alla år som har studerats.Variationen från år till år i PODY för vete och potatis är större än för generic crops pågrund av att ett högre tröskelvärde används i beräkningen av PODY för de specifikagrödorna. Kritiska nivåer motsvarande skördeförluster på 5 % uppnås i södra delen avSverige för fyra av de fem studerade åren för vete och för två av åren för potatis.Det uppdaterade programpaketet för PODY-beräkningar skulle kunna användas förberäkningar av PODY för olika typer av vegetation för perioden 1990-2013 baserat pååteranalyserade ozonkoncentrationer. Programpaketet kan också utvecklas förberäkningar av PODY för hela Europa baserat på olika typer av utsläpps- ochklimatsscenarier.PODY presenteras tillsammans med övriga ozonmått på SMHI:s miljöövervakningssida(www.smhi.se/klimatdata/miljo/atmosfarskemi) med start från miljöövervakningsåret2013.

  • 4.
    Sjökvist, Elin
    et al.
    SMHI, Affärsverksamhet.
    Abdoush, Diala
    SMHI, Samhälle och säkerhet.
    Sommaren 2018 - en glimt av framtiden?2019Rapport (Annet vitenskapelig)
    Abstract [sv]

    Vädret sommaren 2018 var extremt sett till vad vi upplevt under 1900-talet. Den långvariga värmen gav nya värmerekord och i kombination med mindre nederbörd än normalt utbredd torka. Torkan ledde till skogsbränder och påfrestning på lantbruk och djurhållning. Värmeböljorna orsakade också hälsoproblem och fler dödsfall än normalt noterades under sommaren. Var sommaren 2018 en glimt av framtiden? Motsvarar sommaren 2018 vad som kan komma att bli en medelsommar i slutet av seklet?

    För att svara på den frågan jämförs här sommaren 2018 med beräknade medelvärden för en 30-årsperiod i slutet av seklet. Dessa klimatscenarier har SMHI tidigare publicerat i länsvisa rapporter. Denna rapport är tänkt att vara till hjälp för de samhällsfunktioner som vill utvärdera hur sommaren 2018 påverkat verksamheten och vad vi kan förvänta oss av framtiden.

    Analyserna i rapporten visar att de parametrar som väljs för att studera klimatet har stor betydelse för resultatet. Medeltemperaturen för sommarmånaderna visar att sommaren var två till drygt tre grader varmare än perioden 1961-1990. Det är ungefär lika mycket som beräknas enligt scenario RCP4.5 (medelhöga utsläpp) till slutet av seklet. Men månadsvis statistik visar att både maj och juli 2018 var mer än fem grader varmare än normalt på flera platser. Det motsvarar beräknad ökning i RCP8.5 (höga utsläpp) till slutet av seklet.

    Jämförelserna av högsta dygnsmedeltemperatur, antal varma dagar och kylbehov för sommaren 2018 varierar geografiskt men motsvarar förväntad ökning mitt emellan scenarierna RCP4.5 och RCP8.5 i slutet av seklet. Årets längsta värmebölja är mycket likt det beräknade medelvärdet enligt RCP8.5 i slutet av seklet för Östersjökusten. För övriga Sverige hamnar resultaten mitt emellan RCP4.5 och RCP8.5.

    Sommaren 2018 var mycket nederbördsfattig och torr. I de klimatscenarier som analyseras här råder en viss osäkerhet kring om nederbörden ökar eller minskar i södra Sverige i framtiden, men inget av scenarierna visar att nederbördsmängderna sommaren 2018 blir vanliga i framtiden.

    Antalet dagar med lågflöde var många under sommaren 2018 och i Norrland fler än vad klimatscenarierna visar i medeltal för slutet av seklet. I södra Sverige var situationen jämförbar med medelvärdet enligt RCP8.5 i slutet av seklet.

    Små nederbördsmängder i kombination med hög temperatur orsakade torra marker i hela landet. Södra Götaland var extremt torrt jämfört med 1961-1990 och torrare än en medelsommar i slutet av seklet oavsett scenario. Mellersta Sverige uppvisar samma nivå som medelvärdet i RCP8.5 i slutet av seklet medan norra Sverige väntas bli torrare än sommaren 2018 i framtiden.

    Analyserna ger var för sig en bild av hur sommaren 2018 förhåller sig till det framtida klimat som finns beskrivet i SMHIs länsanalyser. En sommar som 2018 kan förekomma i slutet av seklet oavsett nivå av framtida utsläpp av växthusgaser, men sannolikheten att den förekommer är olika för olika väderparametrar och ändras med ökad klimatpåverkan.

  • 5.
    Josefsson, Weine
    SMHI, Samhälle och säkerhet.
    Long-term global radiation in Stockholm, 1922-20182019Rapport (Annet vitenskapelig)
    Abstract [en]

    In 1922 monitoring of global irradiation started in Stockholm, Sweden. Over the years SMHI has been measuring this meteorological quantity with various instruments and at different sites within Stockholm. This type of changes of instruments and sites cause minor, but important systematic changes in the measured global irradiation. Therefore, it is not recommended to directly compare the results from different periods.The report presents methods how this can be done and there is a final data set with long-term global radiation data for Stockholm. Daily and monthly final data are presented on a web-page at www.smhi.seAs a bi-product the sunshine duration was also digitized, controlled and corrected. These data can be found in Appendix 3.

  • 6.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Annet vitenskapelig)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet.

    IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom.

    I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras ävenkunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 7.
    FN:s klimatpanel – Sammanfattning för beslutsfattare Global uppvärmning på 1,5ºC2019Rapport (Fagfellevurdert)
    Abstract [sv]

    Denna rapport har tagits fram på förfrågan till IPCC ”… att till år 2018 ta fram en specialrapport om konsekvenserna av 1,5°C uppvärmning jämfört med förindustriella nivåer och relaterade globala utsläppsbanor av växthusgaser”. Detta framgår av 21:a partskonferensen av FN:s ramkonvention om klimatförändringar beslut om antagande av Parisavtalet. IPCC beslutade i april 2016 att ta fram denna specialrapport om effekter av global uppvärmning på 1,5°C över förindustriella nivåer och relaterade utsläppsbanor av växthusgaser, i syfte att stärka den globala förmågan att svara upp mot hotet från klimatförändringen, målsättningar inom hållbar utveckling och ansträngningar för att utrota fattigdom. I denna Sammanfattning för beslutsfattare (“Summary for Policy Makers”, SPM) presenteras specialrapportens viktigaste slutsatser baserat på utvärderingen av tillgänglig vetenskaplig, teknisk och socioekonomisk litteratur med relevans för en global uppvärmning på 1,5°C och för att kunna jämföra mellan en global uppvärmning på 1,5°C och 2°C över förindustriell nivå. Konfidensnivån för varje central slutsats anges med IPCC:s standardiserade terminologi. Den vetenskapliga grunden för varje slutsats anges genom referenser till avsnitt i respektive kapitel. I sammanfattningen identifieras även kunskapsluckor, med hänvisning till relevanta underliggande kapitel.

  • 8.
    Andersson, Stefan
    et al.
    SMHI, Affärsverksamhet.
    Arvelius, Johan
    SMHI, Affärsverksamhet.
    Jones, Jörgen
    SMHI, Affärsverksamhet.
    Kindell, Sven
    SMHI, Affärsverksamhet.
    Leung, Wing
    SMHI, Affärsverksamhet.
    Beräkningar av emissioner och halter avbenso(a)pyren och partiklar frånsmåskalig vedeldning: Luftkvalitetsmodellering för Skellefteå, Strömsunds och Alingsås kommuner2019Rapport (Annet vitenskapelig)
    Abstract [sv]

    I denna studie har emissioner och halter i utomhusluften av benso(a)pyren (B(a)P) samt partiklar (PM2.5) beräknats för Skellefteå, Strömsunds och Alingsås kommuner avseende småskalig uppvärmning. Emissioner har beräknats för hela kommunerna, medan luftkvalitet har modellerats för två tätorter i varje kommun; Boliden och Bureå i Skellefteå kommun, Backe och Hoting i Strömsunds kommun samt Alingsås och Sollebrunn i Alingsås kommun. De tre kommunerna valdes då de identifierades ha höga B(a)P-halter i den tidigare nationella B(a)P-kartläggningen samt tillgång till sotarregister av tillräcklig bra kvalitet; tätorterna valdes genom att analysera emissionsberäkningarna i varje kommun och välja ut tätorter med de högsta emissionerna.

    Syftet med studien är undersöka hur B(a)P- och PM2.5-halterna i Sverige förhåller sig till miljökvalitetsnormer, utvärderingströsklar samt preciseringen av miljökvalitetsmålet Frisk luft och analysera hur stort gapet är för att klara dessa. Detta genom spridningsmodellering samt utvärdering mot mätningar i fem av tätorterna. Osäkerheterna i den tidigare gjorda nationella karteringen av B(a)Phalter från småskalig vedeldning (Andersson et al., 2015), som ska ses som en preliminär bedömning av halterna, utvärderas också. Vidare undersöks, genom känslighetsanalys, hur antaganden om emissionsfaktorer och eldvanor påverkar luftkvaliteten i områdena. En av de åtgärder som utreds är att byta ut gamla vedpannor mot moderna eldstäder. Luftmiljövinsterna av detta undersöks också genomspridningsmodellering.

    Emissionerna från eldstäderna har beräknats utifrån information från sotarregister i de olika kommunerna, där eldstäderna har klassificerats som vedpannor (miljögodkända och ickemiljögodkända), lokaleldstäder, flis- och pelletspannor samt övriga pannor (mest oljepannor). Geolokalisering, dvs. framtagandet av koordinater, har gjorts för de olika eldstäderna i registren baserat på adresser. Med hjälp av modellerade energibehov för ett genomsnittligt meteorologiskt kalenderår för perioden 1960-1990, för ett genomsnittligt småhus, samt antaganden om emissionsfaktorer, eldstäders nyttjandegrad samt verkningsgrad har sedan emissionerna beräknats.

    Lokalskalig spridningsmodellering med en rumslig upplösning om 20 m × 20 m har genomförts för de utvalda tätorterna med den Gaussiska lokalskaliga spridningsmodellen Dispersion, som är samma lokala modell som finns i modellsystemet SIMAIR-ved. Vid spridningsmodelleringen har meteorologiska data från Mesan för kalenderår 2016 och 2017 använts. Bakgrundshalter har inkluderats för PM2.5, men enbart lokalt haltbidrag från småskalig uppvärmning har beräknats för B(a)P; ett schablontillägg av bakgrundshalter för B(a)P har gjorts för varje tätort. Modelleringen har också utvärderats mot preliminära mätresultat (månadsprovtagning) av B(a)P avseende juni- december 2017 i Boliden, Bureå, Backe, Hoting samt Alingsås tätort samt mätningar av PM2.5 i Bureå och Backe (mätningarna har utförts av Svenska Miljöinstitutet IVL på uppdrag av Naturvårdsverket)

  • 9.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2018 - Extent of Anoxia and Hypoxia, 1960-20182018Rapport (Annet vitenskapelig)
    Abstract [en]

    A climatological atlas of the oxygen situation in the deep water of the Baltic Sea was first published in 2011 in SMHI Report Oceanography No 42. Since 2011, annual updates have been made as additional data have been reported to the ICES data center. In this report the results for 2017 has been updated and the preliminary results for 2018 are presented. Oxygen data from 2018 have been collected from various sources such as international trawl survey, national monitoring programmes and research projects with contributions from Poland, Estonia, Latvia, Russia, Denmark, Sweden and Finland. For the autumn period each profile in the dataset was examined for the occurrence of hypoxia (oxygen deficiency) and anoxia (total absence of oxygen). The depths of onset of hypoxia and anoxia were then interpolated between sampling stations producing two surfaces representing the depth at which hypoxic and anoxic conditions respectively are found. The volume and area of hypoxia and anoxia have been calculated and the results have then been transferred to maps and diagrams to visualize the annual autumn oxygen situation during the analysed period. The updated results for 2017 and the preliminary results for 2018 show that the severe oxygen conditions in the Baltic Proper after the regime shift in 1999 continue. Both the areal extent and the volume with anoxic conditions have, after 1999, been constantly elevated to levels only observed occasionally before the regime shift. Despite the frequent inflows to the Baltic Sea during the period 2014-2016 approximately 22% of the bottom area was affected by anoxia and 32% by hypoxia during 2018. The preliminary results indicate that this is the largest area affected by anoxia during the analysed period, starting 1960. The hydrogen sulphide that had disappeared from the Eastern and Northern Gotland Basin due to the inflows in 2014-2016 is now steadily increasing in the deep water again.

  • 10.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Wikberger, Christina
    Amorim, Jorge Humberto
    SMHI, Forskningsavdelningen, Luftmiljö.
    Klimatanpassa nordiska städer med grön infrastruktur2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Förtätning av städer och pågående klimatförändring ökar behovet av anpassningsåtgärder. Grön infrastruktur och naturbaserade lösningar kan bidra till att skapa mer hälsosamma och långsiktigt hållbara städer. För att öka användningen av grön infrastruktur som en del i klimatanpassningen behöver vi förstå vilka kunskapsluckor och andra hinder som ligger i vägen för att grön infrastruktur ska användas i klimatanpassningsarbetet.

    SMHI har under år 2018 tillsammans med Stockholms stad drivit det av forskningsrådet Formas finansierade projektet ”Grön infrastruktur och klimat i nordiska städer: idag och i framtiden”. Sammanställningen av rapporter och workshops i projektet visar att det finns mycket kunskap och tillgängliga exempel på hur urbana gröna lösningar kan se ut. Det saknas dock svar på de kvantitativa effekterna av olika åtgärder avseende till exempel temperatur, luftkvalitet, påverkan på hälsa och sociala aspekter.

    De åtgärder som i dag görs i nordiska städer baseras huvudsakligen på behovet av att lösa dagvattenfrågor. Det finns få exempel på städer som använder grön infrastruktur och naturbaserade lösningar som klimatanpassningsåtgärder när det gäller värme. Samtidigt är aktörerna medvetna om övriga positiva effekter som tillkommer såsom trivsel, svalka och biologisk mångfald.

    Eftersom grön infrastruktur och naturbaserade lösningar är ganska nya åtgärder i klimatanpassningsarbetet så saknas oftast erfarenheter av långtidseffekter. Skötsel kan vara ett problem, trots bra anvisningar. Aktörerna pekar också på behovet av att engagera de boende kontinuerligt. Det tycks handla om att skapa en djupare förståelse för varför anläggningar ser ut som de gör och hur de ska skötas.

    Vid workshops och webbinarium efterfrågades vilka kunskapsluckor deltagarna såg. Ekonomi och kunskap om effekter lyftes fram tydligt i svaren. Dessutom önskades metoder för anläggning och drift, goda exempel, planeringsverktyg och underlag om temperatur och vatten.

    Ekonomi och kunskapsbrist ansågs som hinder för genomförande, vilket framkom vid workshops och webbinarium. Andra hinder som nämndes var politiska beslut, lagstiftning, avsaknad av riktlinjer, förtätning och konkurrens om mark liksom planerings- och samordningssvårigheter. En tröghet i att ändra traditionellt planerande och utförande pekades också ut som hinder. Många efterfrågar kunskap allmänt. Vår förhoppning är att denna rapport kan bidra till att inspirera och informera om var material finns. 

  • 11.
    Karlson, Bengt
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Mohlin, Malin
    Hu, Ye O.O.
    Andersson, Anders F.
    Miljöövervakning av växtplankton i Kattegatt och Östersjön med rDNA-barcoding och mikroskopi: En jämförelse av molekylärbiologisk metodik och mikroskopi.2018Rapport (Annet vitenskapelig)
  • 12.
    Andersson, Camilla
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord Wylde, Helene
    SMHI, Affärsverksamhet.
    Engardt, Magnuz
    SMHI, Forskningsavdelningen, Luftmiljö.
    Long-term sulfur and nitrogen deposition in Sweden: 1983-2013 reanalysis2018Rapport (Annet vitenskapelig)
    Abstract [en]

    A unique long-term (1983-2013) dataset of sulfur and nitrogen deposition has been compiled for Sweden as well as the Baltic Sea and surrounding countries, based on quality controlled measurements and modelled fields, fused though advanced methods capturing spatial and temporal variations. The data set can be used for describing trends in deposition to various relevant surface types.Our reanalysis compares well to observations, but we have identified differences in dry deposition to coniferous forest. This calls for more in-depth studies of the dry deposition and improvements to the respective methods.We recommend more advanced methods of describing spatial variation than averaging or spatial interpolation of observed deposition.We estimate a significant decrease from the 1980s until today for both sulfur and nitrogen deposition (by ca. 80% and 30% respectively).Critical loads for coniferous and deciduous forests, mountain vegetation and wetlands have been surpassed mainly in the southwest Sweden, but also in southeast Sweden and the southern parts of Scandes Mountains. The situation is improving, but exceedances do still occur also in larger regions.

  • 13.
    Leung, Wing
    et al.
    SMHI, Affärsverksamhet.
    Windmark, Fredrik
    SMHI, Affärsverksamhet.
    Brodl, Ludvik
    SMHI, Affärsverksamhet.
    Langner, Joakim
    SMHI, Forskningsavdelningen, Luftmiljö.
    A basis to estimate marginal cost for air traffic in Sweden.: Modelling of ozone, primary and secondary particles and deposition of sulfur and nitrogen.2018Rapport (Annet vitenskapelig)
    Abstract [en]

    In this study we have investigated the effects of emissions from aviation on air quality in both Swedish and European domains. The results will be used as a basis to estimate the marginal cost for air traffic in Sweden. The vertical, geographical and temporal distribution of aviation emissions over Sweden has been estimated using a newly developed methodology. The aviation emissions have been categorized by their emission altitude (LTO, low cruise and high cruise) and flight nationality (international, national and overflight). This aviation emission information was then used as input data to the regional atmospheric chemistry model MATCH to simulate the effects of aviation emissions on ecosystem, health and climate metrics. A total of 17 model simulations over three years have been performed. There is one simulation in which all emitted species from the surface and aviation emissions are included and eight simulations in which all aviation emissions from each combination of emission altitude and flight nationality are included. There are eight simulations in which NOx aviation emissions from each combination of emission altitude and flight nationality are included. Using these simulations, contributions from aviation emissions to deposition, concentrations and a range of different air pollution metrics has been calculated. The results are calculated in both the Europe and Swedish domains for all the simulations. 

    The following results are included in this report: . Deposition of oxidised and reduced nitrogen . Deposition of excess sulfur . AOT40 and SOMO35 and their exposures . Concentration and exposure of primary and secondary particles . Concentration of nitrate and sulfate particles . Concentration of surface and above surface ozone 

    In summary, contributions from aviation emissions in Sweden to the different concentrations, deposition and metrics for environmental effects are generally small, on the order of a few per mille or less. However the impacts can be traced in the simulations well beyond the Swedish borders. LTO emissions give the largest contribution to deposition of oxidised and reduced nitrogen, deposition of excess sulfur and concentrations of primary and secondary particles. In particular near the major airports like Stockholm-Arlanda and Gothenburg-Landvetter. High cruise emissions give insignificant contributions to deposition and concentrations at surface level. LTO emissions give a negative contribution to surface ozone concentration locally at the main Swedish airports but give an overall increased contribution in the regions around. Aviation emissions at low cruise and high cruise levels have the largest effect on ozone concentrations at higher levels. 

  • 14. Colette, Augustin
    et al.
    Schucht, Simone
    Ciarelli, Giancarlo
    Létinois, Laurent
    Meleux, Frédérik
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    Cuvelier, C.
    Manders, A.
    Mar, K.A.
    Mircea, M.
    Pay, T.
    Raffort, V.
    Tsyro, S.
    Adani, M.
    Bergström, Robert
    SMHI, Forskningsavdelningen, Luftmiljö.
    Bessagnet, G
    Briganti, A.
    Cappelletti, A.
    Couvidat, F.
    D'Isidoro, M.
    Fagerli, H.
    Ojha, N.
    Otero, N.
    Wind, P.
    Long-term air quality trends in Europe Fine Particulate Matter (PM2.5) Health Impacts.2018Rapport (Annet vitenskapelig)
  • 15.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    The SwedishNational MarineMonitoringProgramme 2017: HydrographyNutrientsPhytoplankton2018Rapport (Annet vitenskapelig)
    Abstract [en]

    This report presents the main results of the Swedish national marine monitoring programme of the pelagic during 2017. The monitoring data of hydrography, nutrients and phytoplankton are analysed for the seas surrounding Sweden: Skagerrak, Kattegat, The Sound, Baltic Proper, Bothnian Sea and Bothnian Bay. The monitoring is carried out by SMHI (Swedish Meteorological and Hydrological Institute), SU (Stockholm University) and UMF (Umeå Marine Sciences Centre) and the monitoring programme is co-funded by SwAM (Swedish Agency for Marine and Water Management), SMHI, SU and UMF. Data is collected, analysed and reported with support from Swedish environmental monitoring and commissioned by SwaM.

    The Baltic current along the Swedish west coast implies large variations in surface salinity and the unusually large outflow of brackish water from the Baltic Sea in 2017 was reflected as low surface salinity in Skagerrak and Kattegat in the beginning of the year. There were no major deep water inflows to the Baltic Sea during 2017 but a few inflows of minor magnitude. These minor inflows only temporarily improved the oxygen condition in the Bornholm Basin and in the southern part of the Eastern Gotland Basin.

    The salinity below the halocline was above normal in the Gotland Basins and in the Northern Baltic Proper, and also in the surface layer in the Eastern Gotland Basin for almost the whole year.

    In Skagerrak and Kattegat, surface concentrations of phosphate and dissolved inorganic nitrogen were normal while dissolved silica concentrations were elevated especially in spring. In the Baltic Sea, the concentration of silicate in the surface water was elevated in all basins. According to the estimated total content of silicate there has been an increase in silica content in the Baltic Sea since the early 1990’s. Surface concentrations of phosphate were above normal in the Gotland basins and the Northern Baltic Proper while inorganic nitrogen content was above normal in parts of the Arkona and Bornholm basins. During spring and summer, the inorganic nitrogen was consumed at greater depths than usual in the Baltic Proper. In particular concentrations of phosphate and dissolved silica were generally lower than normal in the bottom layer.

    Instead of diatoms, the flagellate genus Pseudochattonella, which is potentially toxic to fish, bloomed in the Kattegat and Skagerrak areas in February – April. During autumn there was a prolonged diatom bloom though. In the Baltic Sea spring bloom occurred in April. The cyanobacteria bloom began in May already with Aphanizomenon flos-aquae. During June and July all three of the filamentous cyanobacteria, A. flos-aquae, Dolichospermum lemmermannii and the potentially harmful Nodularia spumigena were found in the phytoplankton samples in various amounts.

    In the Bothnian Sea, the sea surface temperature during summer was lower than normal and the oxygen conditions in the bottom layer was not critical but still below normal levels.

  • 16.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2017 - Extent of Anoxia and Hypoxia, 1960-20172018Rapport (Annet vitenskapelig)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES. I denna rapport har resultaten från 2016 uppdaterats. De preliminära resultaten för 2017 baseras på data insamlade under Baltic International Acoustic Survey (BIAS) och nationell miljöövervakning med bidrag från Sverige, Finland och Polen.

    Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten.

    Resultaten för 2016 och de preliminära resultaten för 2017 visar att de extremasyreförhållanden som observerats i Egentliga Östersjön fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots ett flertal inflöden under perioden 2014-2016 beräknas ungefär 18% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 28% av hypoxi under 2017. Inflödena 2014-2016 har minskat poolen av svavelväte så att den nästan helt försvunnit i Östra och Norra Gotlandsbassängen. Dock är syrgashalterna fortsatt noll eller mycket nära noll i djupvattnet och tecken på ökade halter av svavelväte har noterats under 2017.

  • 17.
    Lindström, Göran
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Bartosova, Alena
    SMHI, Forskningsavdelningen, Hydrologi.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Strömqvist, Johan
    SMHI, Forskningsavdelningen, Hydrologi.
    Uppehållstider i ytvatten i relation tillvattenkvalitetNET, ett generellt uppskalningsverktyg2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    NET är ett verktyg för uppskattning av vattenburen transport av olika ämnen i punkter där detsaknas mätningar. Verktyget togs ursprungligen fram inom forskningsprogrammet ”Climatechange and the Environmental Objectives” (CLEO, Munthe et al., 2014 och 2016). Tanken äratt NET ska vara generellt, och kunna användas för simulering av olika ämnen, men endastberäkna medelvärden över tiden av mängder och koncentrationer. Ofta är det mängder som ärslutmålet för en beräkning, varför det i vissa situationer kan finnas mycket att vinna på attanvända en enkel och snabb beräkningsmodell. Inom CLEO simulerades flöden av totalkväve,total-fosfor och totalt organiskt kol.

  • 18.
    Olsson, Jonas
    et al.
    SMHI, Forskningsavdelningen, Hydrologi.
    Berg, Peter
    SMHI, Forskningsavdelningen, Hydrologi.
    Eronn, Anna
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Simonsson, Lennart
    SMHI, Forskningsavdelningen, Hydrologi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Yang, Wei
    SMHI, Forskningsavdelningen, Hydrologi.
    Extremregn i nuvarande och framtida klimat Analyser av observationer och framtidsscenarier2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Studien har främst omfattat analyser av extrem korttidsnederbörd i observationer från SMHIs nät av automatiska meteorologiska stationer. Även analyser av korttidsnederbörd från kommunala mätare, manuella meteorologiska stationer, väderradar och klimatmodeller har genomförts. De huvudsakliga slutsatserna från detta uppdrag kan sammanfattas enligt följande.

    • En regionalisering av extrem korttidsnederbörd (skyfall) i Sverige gav fyra regioner: sydvästra (SV), sydöstra (SÖ), mellersta (M) och norra (N) Sverige. Ytterligare indelning kan göras men i denna studie prioriterades att ha regioner av denna storleksordning för att få ett ordentligt underlag för regional statistik. Regionaliseringen gäller enbart korttidsnederbörd, upp till maximalt 12 tim varaktighet.
    • Den regionala statistiken uppvisar tämligen distinkta geografiska skillnader, med högst värden i region SV och lägst i region N. Det är inte förvånande att vårt avlånga land uppvisar regionala skillnader då varmare och fuktigare luftmassor förekommer mer i söder än i norr, och därmed ökar förutsättningarna för intensiv nederbörd. Den regionala statistiken överensstämmer överlag väl med motsvarande statistik i våra grannländer.
    • Under perioden 1996-2017 finns inga tydliga tidsmässiga tendenser vad gäller skyfallens storlek och frekvens i de olika regionerna, utan dessa ligger överlag på en konstant nivå. Inte heller extrem dygnsnederbörd sedan 1900 uppvisar några tydliga tendenser på regional nivå. På nationell nivå indikeras en svag ökning av dels landets högsta årliga nederbörd sedan 1881, dels förekomsten av stora, utbredda 2-dygnsregn sedan 1961.
    • Skyfallsstatistik baserad på nederbördsobservationer från väderradar som justerats mot interpolerade stationsdata (HIPRAD) överensstämmer väl med stationsbaserad statistik för korta varaktigheter (upp till 2 tim) i södra Sverige. För längre varaktigheter och i mellersta och norra Sverige överskattar HIPRAD regnvolymerna.
    • Analyser av de senaste klimatmodellerna (Euro-CORDEX) indikerar en underskattning av extrema regnvolymer för korta varaktigheter (1 tim) men överlag en realistisk beskrivning av observerad skyfallsstatistik. Den framtida ökningen av volymerna beräknas ligga mellan 10% och 40% beroende på tidshorisont och koncentration av växthusgaser, vilket överlag ligger nära tidigare bedömningar.

    Både för bedömningen av regionala skillnader och historiska klimateffekter är det av största vikt att bibehålla, eller ännu hellre utöka, observationerna av korttidsnederbörd i Sverige. Nederbördsmätning via alternativa tekniker bör kunna användas i allt högre utsträckning framöver för förbättrad kunskap och statistik. Väderradar är redan etablerat och den digitala utvecklingen öppnar även möjligheter till insamling av nederbördsdata och relaterad information via mobilmaster, uppkopplade privata väderstationer, sociala medier, etc. Denna utveckling måste bevakas, utvärderas och i största möjliga utsträckning utnyttjas.

  • 19.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden. Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra största sjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren är mycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är det Vänern som har de största problemen i dagens klimat och fram till slutet av detta sekel, medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längre tidsperspektiv.

    Klimatförändringarna medför bland annat förändrade vattennivåer, förändrade vattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilket ger konsekvenser för olika intressen runt sjöarna.

    En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte är tydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är ett hinder för att komma vidare med de problem som idag finns för Vänern och för den långsiktiga klimatanpassningen av Mälaren, bortom detta sekel.

    Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring:

    • Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna
    • Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vatten och kortare perioder med is.
    • Modellering av hur råvattenkvaliteten förändras i framtiden.
    • Mer observationer för att fånga upp klimateffekter i sjöarna.

    Till varje sjö har en referensgrupp bestående av representanter för olika intressen kring sjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inom ramen för projektet och frågeställningar som kommit upp under möten med referensgrupperna, men även befintlig litteratur har använts.

  • 20.
    Södling, Johan
    et al.
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Statistisk metodik för beräkning av extrema havsvattenstånd2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Som ett led i arbetet att förbättra metoderna för planeringsunderlag gällande extrema havsvattenstånd har SMHI gjort en inventering av statistiska metoder för extremvärdesanalys. Metoderna är vanligt förekommande när olika dimensioneringsunderlag tas fram. För att ta fram statistik med hög tillförlitlighet för händelser som har låg sannolikhet (hög återkomsttid) har dock metoderna begränsad användning.

    Tre huvudsakliga metoder har applicerats på SMHI:s havsvattenståndsdata. Den mest vanliga, Blockmaximum-metoden, används vanligtvis på årshögsta vattenstånd. POT – metoden (Peak Over Threshold), använder fler data och är inte lika vanlig. I Norge används en variant av POT – metoden, den så kallade ACER-metoden (Average Conditional Exceedance Rate). Den är mycket lämplig för att ta fram värden för lägre återkomsttider, och är förhållandevis robust när data läggs till vartefter.

    Metodernas lämplighet och känslighet utvärderades för extrema havsvattenstånd, alltså havsvattenstånd med höga återkomsttider(låg sannolikhet). Slutsatsen är att det inte går att välja en metod som överlägsen den andra, och att kunskap om den aktuella platsens oceanografiska förhållanden behövs för att utvärdera resultatens rimlighet. I alla analyser av extrema havsvattenstånd är det viktigt att beakta datakvalité och dataseriens längd. Resultat bör redovisas med konfidensintervall.

    Blockmaximum-metoden testades med olika fördelningar. Gumbel-fördelning visar sig kunna ge orimliga nivåer för vattenståndsextremer och rekommenderas därför inte. GEV (Generalized Extreme Value) och Log-normal fördelning används med fördel i kombination.POT-metoder tar till vara fler händelser än de riktigt extrema, men resultaten som ges har väldigt stora konfidensintervall som växer för låg sannolikhet. Om tröskeln sätts för låg är det inte extremvattenstånd som utvärderas.

    Som en följd av denna analys bestämdes att andra metoder behöver tas fram för att studera de högsta havsvattenstånden längs Sveriges kust. I Schöld m.fl. (2017) redovisas hur man kan gå till väga för att ta fram högsta beräknade havsvattenstånd utifrån befintliga data.

  • 21.
    Karttjänst för framtida medelvattenstånd längs Sveriges kust2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Havsnivån stiger och orsaken är den globala uppvärmningen. Effekterna av uppvärmningen på havets nivå kommer främst från den termiska expansionen samt bidrag från smältande glaciärer och de stora landisarna på Grönland och Antarktis.

    Hur snabbt den globala havsnivån stiger beror på hur stora utsläppen av växthusgaser blir. Globala medelvattenstånd fram till år 2100 har framtagits inom IPCC och beskrivs utifrån klimatscenarier, som innebär olika antaganden om den framtida utvecklingen. Oavsett klimatscenario stiger havsnivån och den kommer att fortsätta stiga även efter år 2100. Störst osäkerhet råder, angående framtida havsnivåer, kring avsmältningen av de stora ismassorna på Grönland och Antarktis.

    Medelvattenståndet är den nivå som avgör var strandlinjen normalt ligger och som höga och låga vattenstånd varierar kring. Medelvattenståndet längs Sveriges kuster kommer att förändras olika mycket, främst beroende på den pågående landhöjningen. Andra regionala processer som kan påverka medelvattenståndet är dåligt kända men bedöms i nuläget vara små.

    Globala medelvattenstånd, framtagna inom IPCC AR5, i kombination med landhöjningsinformation från Lantmäteriet har använts för att göra beräkningar av framtida medelvattenstånd längs svenska kusten. Beräkningarna sträcker sig till år 2100. Medelvattenstånd vid observationsplatser längs kusten för referensperioden 1986-2005 används som utgångsvärde.

    Resultaten har publicerats i en karttjänst som visar medelvattenståndet enligt tre olika utsläppsscenarier kring år 2050 respektive år 2100. Karttjänsten ger indikationer för vilka områden som kan vara sårbara för stigande havsnivåer.

  • 22.
    Nerheim, Signild
    et al.
    SMHI, Affärsverksamhet.
    Schöld, Sofie
    SMHI, Samhälle och säkerhet.
    Persson, Gunn
    SMHI, Affärsverksamhet.
    Sjöström, Åsa
    SMHI, Samhälle och säkerhet.
    Framtida havsnivåer i Sverige2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Sveriges kustområden drabbas ibland av tillfälliga översvämningar i samband med stormar eller då kraftiga lågtryck passerar. Översvämningar kan orsaka allvarliga samhällsstörningar och vatteninträngning i byggnader kan ge upphov till stora kostnader. Den pågående globala uppvärmningen, med stigande havsnivåer som följd, aktualiserar frågan om hur vattenståndet kring svenska kusten kan förändras, idag och i framtiden. Havet stiger och det kommer att pågå under hundratals eller kanske till och med tusentals år framöver.

    SMHI startade 2015 ett projekt för att beskriva havsnivåer längs svenska kusten i dagens och framtidens klimat. Projektet har levererat:

    • Beräknade medelvattenstånd för hela Sveriges kust för år 2050 och år 2100 utifrån tre olika framtida klimatscenarier.
    • En visningstjänst för framtida medelvattenstånd.
    • En beskrivning av hur höga havsvattenstånd kan beräknas för en specifik plats.
    • Höga vattenstånd för SMHI:s mätstationer samt en visualisering av dessa.
    • En översikt över statistisk metodik.
    • En vägledning för utvärdering av lokala effekter.
    • En beskrivning av kända högvattenhändelser i olika kustområden och parametrar och processer relaterade till dessa.

    Denna rapport presenterar en översikt över resultaten som tagits fram i projektet och avslutas med en beskrivning av hur framtidens höga havsnivåer kan bedömas i planeringssyfte. SMHI har i rapporten inte tagit ställning till vilket klimatscenario eller vilken tidshorisont som är mest lämpligt att använda för samhällsplanering. Detta måste bestämmas i ett situationsspecifikt sammanhang där risk och kostnader beaktas. SMHI vill betona att även om år 2100 ofta anges som slutår för klimatscenarier, så kommer havets nivå att fortsätta att stiga längre än så.

    Rapporten summerar resultat från övriga rapporter som framtagits inom projektet. För ytterligare detaljer hänvisas till dessa (se Förord).

  • 23.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Hellström, Sverker
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Kållberg, Per
    SMHI, Forskningsavdelningen, Meteorologi.
    Lindow, Helma
    SMHI, Samhälle och säkerhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Schimanke, Semjon
    SMHI, Forskningsavdelningen, Oceanografi.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Wern, Lennart
    SMHI, Samhälle och säkerhet.
    Vattenståndsdynamik längs Sveriges kust2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    För att skapa ett samhälle väl anpassat till dagens och framtidens havsnivåer behövs besluts- och planeringsunderlag. Skyddsåtgärder och designnivåer för kustskydd är högaktuella frågor och många aktörer är intresserade av information kring potentiella maxnivåer för vattenstånd på olika tidshorisonter. SMHI har därför analyserat de mätdataserier för havsvattenstånd som idag finns tillgängliga från stationer längs Sveriges kust. Det primära syftet var att ta fram en metod för att beräkna det högsta möjliga havsvattenståndet vid mätstationer längs Sveriges kust. Metoden beskrivs i Schöld m.fl.(2017).

    I föreliggande rapport beskrivs allmänt havsnivåer, mätdata, modeller och de resultat som erhölls från olika analyser av mätdata. Mätstationerna indelades i åtta olika kustområden inom vilka vattenståndet samvarierar. Det väder och de specifika stormbanor, som under de senaste 40 åren orsakat de högsta stormfloderna på olika platser längs den svenska kusten kartlades, och vattenståndsdynamiken vid olika mätstationer studerades.

    Kortvariga höjningar av vattenståndet undersöktes, både med avseende på kraftiga vattenståndshöjningar orsakade av passerande väderssystem och med avseende på förhöjda utgångslägen, som i sin tur kan bidra till att stormfloder blir extra höga.

    Det högsta beräknade havsvattenstånd som presenteras är de högsta möjliga stormfloder som skulle kunna inträffa baserat på empiriska analyser av mätdata vid de olika stationerna. Kända extrema händelser, som ägt rum före det att vattenståndet började registreras, ingår inte eftersom de inte har kunnat kvantifieras. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport.

    Resultaten från studien visar att vattennivåerna i Östersjön generellt blir som högst i Bottenviken och i de södra delarna. De höga vattenstånden i större delen av Östersjön är inte lika höga som på västkusten och i Öresund. I Östersjön förefaller också utgångsläget, havsnivån före stormen, utgöra en större del av den resulterande vattenståndshöjningen. Vid flera stationer i de centrala delarna av Östersjön är havsnivån före storm i stort sett hälften av det högsta beräknade havsvattenståndet. Längs västkusten är istället de nettohöjningar som orsakas av rena stormeffekter den viktigaste stormflodskomponenten. Lokala förhållanden, till exempel om stationen är belägen vid en öppen, rak kust eller inne i en vik, påverkar hur högt vattenståndet kan förväntas bli på en viss plats.

    Analyserna visar att stormfloder skulle kunna bli omkring 20-40 cm högre än hittills observerade maximala nivåer i olika kustområden. En osäkerhetsmarginal på runt +15 cm är lämplig att addera, särskilt i de områden där tidvatten förekommer.

  • 24.
    Johansson, Lasse
    et al.
    SMHI, Affärsverksamhet.
    Gyllenram, Walter
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Lokala effekter på extrema havsvattenstånd2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    När havsvattennivån ska beräknas för en viss plats behöver hänsyn tas till lokala förhållanden. Vattenståndet lokalt kan avvika från det som observeras vid en av SMHI:s eller andras mätplatser. Geografin på platsen och vågor kan leda till högre vattennivåer än de som observeras vid mätplatserna.

    Denna rapport ger en kort beskrivning av hur vattenståndet längs Sveriges kuster byggs upp. Vi ger exempel på olika mekanismer för att läsaren ska få en uppfattning om skalorna i tid och höjd. Vågfenomen lokalt kan leda till att ytterligare högre nivåer kan beröras av vatten än vad vattenståndet anger.

    En översiktlig beskrivning görs av hur vågor interagerar med stränder ochkajer. Begreppen våguppstuvning och våguppsköljning förklaras. Några exempel ges på vilken effekt bottens lutning har och hur vågor utvecklas i hamnar.

    För att beräkna återkomstvärden för vattenstånd på en lokal plats beskrivs hur man kan utgå från de mätningar som SMHI gör sedan många år. Observationer från den närmaste eller de närmaste mätplatserna kan användas för att beräkna vattenstånd med olika återkomsttider för den önskade platsen. Ett exempel på en sådan beräkning presenteras där speciellt viktiga detaljer redovisas.

  • 25.
    Viktorsson, Lena
    et al.
    SMHI, Samhälle och säkerhet.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Revidering av fysikaliska och kemiskabedömningsgrunder i kustvatten: Underlag inför uppdatering av HVMFS 2013:192018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Detta är ett underlag för revidering av bilaga 5 i HVMFS 2013:19, Bedömningsgrunder för fysikaliskkemiskakvalitetsfaktorer i kustvatten och vatten i övergångszonen. Underlaget innefattar främst enuppdatering av referensvärden för näringsämnen samt förslag på uppdatering av viss text i föreskriftengällande syrebalans och siktdjup. Den generella metoden för var och en av stödparametrarna ibedömningsgrunderna bibehålls. I rapportens sista kapitel presenteras de uppdateringar av föreskriftenHVMFS 2013:19 som rekommenderas utifrån detta uppdrag.Efter en jämförelse av tidigare framtagna referensvärden för näringsämnen och de som tagits fram iden här rapporten rekommenderas att nya referensvärden i tillrinnande sötvatten används men atttidigare referensvärden för TN och TP vid utsjösalthalt samt att klassgränser behålls. En mindrejustering av referensvärden för DIN och DIP utifrån havsmiljöförordningens G/M värden föreslåsdock. De nya referensvärdena är framtagna med modellen S-HYPE (Lindström m.fl. 2010) förtillrinnande sötvatten och utifrån utsjövärden för oorganiskt fosfor och kväve (HVMFS 2012:18) samteffektsamband i mätdata. Det förtydligas också att ett konstant referensvärde för näringsämnenanvänds vid salthalter ≤2 psu.Den S-HYPE körning som använts för referensvärden i tillrinnande sötvatten är en bakgrundskörningsom är anpassad till definitionen av bakgrundsbelastning i PLC6 (Pollution Load Compilation 6,HELCOM).Utöver uppdatering av referensvärden för näringsämnen så föreslås en förändrad sammanvägning avkväve och fosfor i bedömningsgrunden. Det innebär att de ingående parametrarna för kväve och fosforsammanvägs var för sig. Bedömningsgrunderna ger då en separat status för varje näringsämne (kväveoch fosfor) baserat på de ingående parametrarna. Detta ger både en större möjlighet till att se vilketnäringsämne som bidrar till att eventuellt sänka status och stämmer överens med hur rapporteringentill EU-kommissionen ska ske.För syre rekommenderas en uppdatering om vilka mätmetoder som får användas, så att ävenmätningar med sensorer kan användas för statusbedömning. För siktdjup var ambitionen att ta fram etthumusgränsvärde för när kvalitetsfaktorn inte ska tillämpas. En fullständig statistisk analys har intehunnits med och en tydlig rekommendation kan inte ges.Det har under arbetet med att ta fram nya referensvärden för näringsämnen enligt nuvarande metodblivit tydligt att metoden för att bedöma näringsämnen behöver en mer övergripande uppdatering. Tillexempel kan metoden för salthaltskorrektion troligen förbättras med hjälp av en analys av mätdata ikombination med kustzonsmodellen.

  • 26.
    Schöld, Sofie
    et al.
    SMHI, Samhälle och säkerhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    Nerheim, Signild
    SMHI, Affärsverksamhet.
    Södling, Johan
    SMHI, Affärsverksamhet.
    Beräkning av högsta vattenstånd längs Sveriges kust2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    I rapporten redovisas hur en metod framtagits för att kunna skatta de allra högsta havsvattenstånd som kan uppträda vid de mätstationer för havsvattenstånd som finns längs Sveriges kust. Metoden är generell och principerna kan därför tillämpas på mätdataserier från olika platser. För att kunna tillämpa metoden måste dock mätdataserien ha en viss minimilängd och tidsupplösning. Resultaten som tas fram är empiriska, vilket betyder att de baseras på tillgängliga mätdata.

    I analysen delades data upp i två delar; det genomsnittliga vattenståndet före en högvattenhändelse och nettohöjningen under en högvattenhändelse. Dessa delar benämns havsnivå före storm respektive nettohöjning, i enlighet med:

    stormflod = havsnivå före storm + nettohöjning

    Nivån på stormfloden är det högsta uppmätta havsvattenståndet under respektive högvattenhändelse. I analysen har även högvattenhändelser som inte förknippas med stormar inkluderats. Många av de högsta stormfloderna har inträffat när havsnivån före storm är förhöjd jämfört med medelvattenståndet, framförallt i stora delar av Östersjön. I analysen ingår samtliga högvattenhändelser från vilka det finns tillgänglig mätdata, även sådana som startat från ett lågt utgångsläge.

    I analysen indelades mätstationerna i olika kustområden och samvariationen mellan mätstationerna undersöktes. För varje enskild station, där havsvattenstånd observeras, har högsta havsnivå före storm och högsta nettohöjning framtagits. Den högsta havsnivån före storm som uppmätts inom kustområdet bedömdes gälla för alla mätstationer inom området. Det högsta beräknade havsvattenståndet definierades som kustområdets högsta havsnivå före storm plus mätstationens högsta nettohöjning.

    Tidvatteneffekten har inte beaktats särskilt, utan är i viss mån inkluderad i nettohöjningen. Denna förenkling beskrivs närmare i Schöld m fl. (2017).

    Analysen visade att:

    • samvariationen inom kustområden är mycket hög för vanligt förekommande vattenstånd.
    • högvattenhändelser förekommer oftare i vissa kustområden.
    • de högsta vattenstånden kan variera mycket, även mellan stationer inom samma kustområde.
    • havsnivån före storm är en mer betydande stormflodskomponent i Östersjön och mindre betydande i Skagerrak-Kattegatt.
    • havsnivån före storm behöver identifieras så att den inte är påverkad av själva stormhändelsen.
    • det är lämpligt att uppdatera det högsta beräknade havsvattenståndet regelbundet,särskilt efter att nya rekordhöga stormfloder inträffat.

    Vi valde att definiera havsnivån före storm som ett medelvärde över sju dygn, 48 timmar före stormflodens maximum. Metodiken avser nivåer ovanpå ett gällande medelvattenstånd. Framtida förändringar av medelvattenståndet orsakade av den globala klimatförändringen behandlas inte i denna rapport. Tillämpningen av metoden i ett framtida klimat beskrivs i Nerheim m fl. (2017).

  • 27.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2018Rapport (Annet vitenskapelig)
  • 28.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Stensen, Katarina
    SMHI, Samhälle och säkerhet.
    Alavi, Ghasem
    SMHI, Affärsverksamhet.
    Jacobsson, Karin
    SMHI, Affärsverksamhet.
    Sveriges stora sjöar idag och i framtiden.: Klimatets påverkan på Vänern, Vättern, Mälaren och Hjälmaren. Kunskapssammanställning februari 2018.2018Rapport (Annet vitenskapelig)
    Abstract [sv]

    I denna rapport beskrivs den klimatrelaterade problematiken kring landets fyra störstasjöar i ett tidsperspektiv fram till 2100. Vänern, Vättern, Mälaren och Hjälmaren ärmycket olika till sin karaktär, men vissa gemensamma problem finns. Av sjöarna är detVänern som har de största problemen i dagens klimat och fram till slutet av detta sekel,medan Mälaren troligtvis är den sjö som kommer få störst problem i ett längretidsperspektiv.Klimatförändringarna medför bland annat förändrade vattennivåer, förändradevattenflöden, ökande vattentemperatur, minskad istäckning och havsnivåhöjning vilketger konsekvenser för olika intressen runt sjöarna.En gemensam svårighet för klimatanpassning kring de stora sjöarna är att det inte ärtydligt vem som ska ta ansvar och kostnader för klimatanpassningsåtgärder. Detta är etthinder för att komma vidare med de problem som idag finns för Vänern och för denlångsiktiga klimatanpassningen av Mälaren, bortom detta sekel.Gemensamt för sjöarna är också att det finns behov av ytterligare underlag kring: Samhällsekonomiska konsekvenser av klimatförändringarna för sjöarna Analyser av hur ekosystemen i de enskilda sjöarna påverkas av varmare vattenoch kortare perioder med is. Modellering av hur råvattenkvaliteten förändras i framtiden. Mer observationer för att fånga upp klimateffekter i sjöarna.Till varje sjö har en referensgrupp bestående av representanter för olika intressen kringsjöarna bildats. Mycket av det som beskrivs i rapporten är underlag som tagits fram inomramen för projektet och frågeställningar som kommit upp under möten medreferensgrupperna, men även befintlig litteratur har använts.

  • 29.
    Eilola, Kari
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Lindqvist, Stina
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Wåhlstrom, Irene
    SMHI, Forskningsavdelningen, Oceanografi.
    Bartoli, Marco
    Klaipeda University, Lithuania.
    Burska, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Carstensen, Jacob
    Aarhus University, Denmark.
    Hellemann, Dana
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hietanen, Susanna
    Department of Environmental Sciences, University of Helsinki, Helsinki, Finland.
    Hulth, Stefan
    Department of Chemistry and Molecular Biology, University of Gothenburg, Gothenburg, Sweden.
    Janas, Urszula
    Institute of Oceanography, University of Gdansk, Poland.
    Kendzierska, Halina
    Institute of Oceanography, University of Gdansk, Poland.
    Pryputniewicz-Flis, Dorota
    Institute of Oceanography, University of Gdansk, Poland.
    Voss, Maren
    Leibniz Institute for Baltic Sea Research Warnemünde, Germany.
    Zilius, Mindaugas
    Klaipeda University, Lithuania.
    Linking process rates with modellingdata and ecosystem characteristics2017Rapport (Fagfellevurdert)
    Abstract [en]

    This report is related to the BONUS project “Nutrient Cocktails in COAstal zones of the Baltic Sea” alias COCOA. The aim of BONUS COCOA is to investigate physical, biogeochemical and biological processes in a combined and coordinated fashion to improve the understanding of the interaction of these processes on the removal of nutrients along the land-sea interface. The report is especially related to BONUS COCOA WP 6 in which the main objective is extrapolation of results from the BONUS COCOA learning sites to coastal sites around the Baltic Sea in general. Specific objectives of this deliverable (D6.4) were to connect observed process rates with modelling data and ecosystem characteristics.

    In the report we made statistical analyses of observations from BONUS COCOA study sites together with results from the Swedish Coastal zone Model (SCM). Eight structural variables (water depth, temperature, salinity, bottom water concentrations of oxygen, ammonium, nitrate and phosphate, as well as nitrogen content in sediment) were found common to both the experimentally determined and the model data sets. The observed process rate evaluated in this report was denitrification. In addition regressions were tested between observed denitrification rates and several structural variables (latitude, longitude, depth, light, temperature, salinity, grain class, porosity, loss of ignition, sediment organic carbon, total nitrogen content in the sediment,  sediment carbon/nitrogen-ratio, sediment chlorphyll-a as well as bottom water concentrations of oxygen, ammonium, nitrate, and dissolved inorganic  phosphorus and silicate) for pooled data from all learning sites.

    The statistical results showed that experimentally determined multivariate data set from the shallow, illuminated stations was mainly found to be similar to the multivariate data set produced by the SCM model. Generally, no strong correlations of simple relations between observed denitrification and available structural variables were found for data collected from all the learning sites. We found some non-significant correlation between denitrification rates and bottom water dissolved inorganic phosphorous and dissolved silica but the reason behind the correlations is not clear.

    We also developed and evaluated a theory to relate process rates to monitoring data and nutrient retention. The theoretical analysis included nutrient retention due to denitrification as well as burial of phosphorus and nitrogen. The theory of nutrient retention showed good correlations with model results. It was found that area-specific nitrogen and phosphorus retention capacity in a sub-basin depend much on mean water depth, water residence time, basin area and the mean nutrient concentrations in the active sediment layer and in the water column.

  • 30.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and  Development of an oxygen consumption  indicator2017Rapport (Annet vitenskapelig)
    Abstract [en]

    This report contains two parts which are self standing reports and a contribution to the HELCOM project EUTRO-OPER. The work has been funded and commissioned by SwAM (Swedish agency for marine and water management) 2014-2015.

    • Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology)

    Eutrophication status is assessed nationally in coastal waters within the Water Framework Directive (WFD) and in open sea areas within the Marine Strategy Framework Directive (MSFD). Both WFD and MSFD consider eutrophication but with different approaches and it is therefore a need for harmonisation in the assessment process.   The Excel based tool HEAT (HELCOM Eutrophication Assessment Tool) has been used in previous assessments in the HELCOM region. There are two versions of the tool; HEAT 1.0 and HEAT 3.0, the first is based on the WFD methodology and the second is based on the MSFD methodology. The main difference between HEAT 1.0 and HEAT 3.0 is how the indicators are grouped. Here we assess the eutrophication status in coastal waters by applying HEAT and compare the results with the national WFD assessments. The present test includes data on 33 selected coastal water bodies in five countries: Estonia, Finland, Latvia, Poland and Sweden. Data on reference condition, acceptable deviation, status and class boundaries of all indicators used in WFD for reporting ecological status (biological and physical-chemical) have been provided for each tested water body. The data has been inserted in the HEAT 1.0 and HEAT 3.0 tools and been compared with the national WFD assessments.   Both HEAT versions gave lower status in more than 50 % of the cases. For some tests the status changed to sub-GES from GES when HEAT is applied. The good/moderate boundary is the same in both HEAT and the WFD while the lower class boundaries in general are stricter in HEAT, which explains the lower status. In national WFD assessments expert judgment is used when there is little, no or very uncertain in situ data. The status in HEAT is given by the one-out-all-out principle but it is still possible to include expert judgment through the weighting factors.

    • Development of an oxygen consumption indicator

    It was investigated if the oxygen consumption can be used as an oxygen indicator for the Baltic Sea. The method is based on the idea of calculating the oxygen consumption in a stabile layer below the productive zone during summer and relating this to nutrient concentrations. With more nutrients available there is an increased biological production. By estimating how much oxygen is needed to mineralise the biological material it may be possible to link the oxygen consumption to eutrophication.

    The oxygen consumption was calculated for the BY15-Gotland Deep in the Eastern Gotland Basin. We identified a stabile layer between 30 and 50 m and a large change in both oxygen and nutrients from June to August. However, the oxygen consumption had a very high inter-annual variation and there were no significant correlation with the winter mean of nutrient concentrations. It was not possible to calculate the diffusion between the layers because of too sparse measurements at the stratification which limits the method. The calculation of the diffusion is however possible to improve with a model. Further on, the depth of the stabile layer is varying between areas and also between years.   We realised that the method has too many restrictions to be a functional indicator. A functional indicator shall not be dependent on heavy modelling or demand too much on expert judgement. We also investigated if a possible candidate to use as a more simple oxygen consumption indicator could be the use of oxygen saturation at a specific depth. If we assume that the temperature has not changed much since the establishment of stratification we may expect that changes in oxygen saturation observed in August at this depth would be caused by the biological oxygen consumption occurring during late spring and summer. The correlation with winter mean nutrients slightly improved in this case.

  • 31.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology) and Development of an oxygen consumption indicator2017Rapport (Annet vitenskapelig)
    Abstract [en]

    This report contains two parts which are self standing reports and a contribution to the HELCOM project EUTRO-OPER. The work has been funded and commissioned by SwAM (Swedish agency for marine and water management) 2014-2015.

    • Coastal eutrophication status assessment using HEAT 1.0 (WFD methodology) versus HEAT 3.0 (MSFD methodology)

    Eutrophication status is assessed nationally in coastal waters within the Water Framework Directive (WFD) and in open sea areas within the Marine Strategy Framework Directive (MSFD). Both WFD and MSFD consider eutrophication but with different approaches and it is therefore a need for harmonisation in the assessment process.  The Excel based tool HEAT (HELCOM Eutrophication Assessment Tool) has been used in previous assessments in the HELCOM region. There are two versions of the tool; HEAT 1.0 and HEAT 3.0, the first is based on the WFD methodology and the second is based on the MSFD methodology. The main difference between HEAT 1.0 and HEAT 3.0 is how the indicators are grouped. Here we assess the eutrophication status in coastal waters by applying HEAT and compare the results with the national WFD assessments. The present test includes data on 33 selected coastal water bodies in five countries: Estonia, Finland, Latvia, Poland and Sweden. Data on reference condition, acceptable deviation, status and class boundaries of all indicators used in WFD for reporting ecological status (biological and physical-chemical) have been provided for each tested water body. The data has been inserted in the HEAT 1.0 and HEAT 3.0 tools and been compared with the national WFD assessments.  Both HEAT versions gave lower status in more than 50 % of the cases. For some tests the status changed to sub-GES from GES when HEAT is applied. The good/moderate boundary is the same in both HEAT and the WFD while the lower class boundaries in general are stricter in HEAT, which explains the lower status. In national WFD assessments expert judgment is used when there is little, no or very uncertain in situ data. The status in HEAT is given by the one-out-all-out principle but it is still possible to include expert judgment through the weighting factors.

    • Development of an oxygen consumption indicator

    t was investigated if the oxygen consumption can be used as an oxygen indicator for the Baltic Sea. The method is based on the idea of calculating the oxygen consumption in a stabile layer below the productive zone during summer and relating this to nutrient concentrations. With more nutrients available there is an increased biological production. By estimating how much oxygen is needed to mineralise the biological material it may be possible to link the oxygen consumption to eutrophication. The oxygen consumption was calculated for the BY15-Gotland Deep in the Eastern Gotland Basin. We identified a stabile layer between 30 and 50 m and a large change in both oxygen and nutrients from June to August. However, the oxygen consumption had a very high inter-annual variation and there were no significant correlation with the winter mean of nutrient concentrations. It was not possible to calculate the diffusion between the layers because of too sparse measurements at the stratification which limits the method. The calculation of the diffusion is however possible to improve with a model. Further on, the depth of the stabile layer is varying between areas and also between years.  We realised that the method has too many restrictions to be a functional indicator. A functional indicator shall not be dependent on heavy modelling or demand too much on expert judgement. 

    We also investigated if a possible candidate to use as a more simple oxygen consumption indicator could be the use of oxygen saturation at a specific depth. If we assume that the temperature has not changed much since the establishment of stratification we may expect that changes in oxygen saturation observed in August at this depth would be caused by the biological oxygen consumption occurring during late spring and summer. The correlation with winter mean nutrients slightly improved in this case.

  • 32.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Fölster, Jens
    Drakare, Stina
    Sonesten, Lars
    Förslag till plan för revidering av fysikalisk-kemiska bedömningsgrunder för ekologisk status i sjöar, vattendrag och kustvatten Del A: SJÖAR OCH VATTENDRAG (SLU) Del B: KUSTVATTEN (SMHI)2017Rapport (Annet vitenskapelig)
  • 33.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Axe, Philip
    SMHI, Forskningsavdelningen, Oceanografi.
    Johansson, Johannes
    SMHI, Samhälle och säkerhet.
    Linders, Johanna
    SMHI, Samhälle och säkerhet.
    Nexelius, Nils
    SMHI, Samhälle och säkerhet.
    Skjevik, Ann-Turi
    SMHI, Samhälle och säkerhet.
    Swedish National Report on Eutrophication Status in the Skagerrak, Kattegat and the Sound - OSPAR ASSESSMENT 20162017Rapport (Annet vitenskapelig)
    Abstract [en]

    The Swedish OSPAR waters were assessed by applying the OSPAR Common Procedure for the time period 2006 – 2014. The Swedish parts of Skagerrak, Kattegat and the Sound constitute the outer part of the transition zone between the estuarine Baltic Sea and the oceanic North Sea and were investigated for nutrients, chlorophyll-a,oxygen, macrophytes, phytoplankton and zoobenthos. The conclusion from the overall assessment of the Swedish OSPAR waters was that only Skagerrak open sea could be classified as a Non-Problem Area and all other assessment units were classified as Problem Areas.  Atmospheric input of nitrogen significantly decreased in both Skagerrak and Kattegat and the land based input of total nutrients also decreased in Skagerrak, Kattegat as well as the Sound. However, the short-term trend of nitrogen input to the Sound was positive. Skagerrak is governed by trans-boundary transports from the North Sea of mainly nitrogen but also phosphorus. Kattegat receives trans-boundary nutrients from both the Baltic Sea through the Sound and from Skagerrak and transports nutrients towards the coast and the western part of the basin.  Overall, concentrations of DIN, DIP, TN and chlorophyll-a decreased in most areas, however, no significant trends were found for DIP. Increasing concentrations were found in silicate, POC and TP. The Secchi depth increased in most areas. Oxygen deficiency was mainly a problem in the fjords and the Kattegat open sea.  In Skagerrak coastal waters winter nutrients were only elevated in the fjords. Concentrations of DIN generally decreased significantly and there were tendencies of decreasing DIP. This pattern was also supported by the total nitrogen while total phosphorus increased. Secchi depth was improving and there was a significant positive trend of increasing depths. However, zoobenthos were still in bad condition and phytoplankton indicator species were often elevated. Chlorophyll-a concentrations were generally decreasing but still elevated in the inner coastal waters. There were also problems with algal toxins such as DST (Diarrhetic Shellfish Toxin) and PST (Paralystic Shellfish Toxin) infections in the area. According to the OSPAR classification scheme, a unit with no evident increased nutrient enrichment can be classified as a Problem Area but the cause might be due to trans-boundary transport from adjacent areas. In the open area of Kattegat there were still problems with oxygen deficiency, especially in the southern parts, even though the trend was significantly positive for the assessment period 2006 – 2014. Concentrations of chlorophyll-a and DIN decreased significantly, however, DIN levels were still generally elevated, especially in the southern parts of Kattegat while DIP was closer to the assessment level. In Kattegat coastal waters winter nutrients were elevated in all assessment units, except from the inner coastal waters, even though there was a general pattern of decreasing going trends. Chlorophyll-a was mainly elevated in the Sound and the estuaries. Secchi depth is generally improving and a significant increase was seen in the Sound. Also in Kattegat, zoobenthos were in bad condition and phytoplankton indicator species were often elevated. 

  • 34.
    Andersson, Pia
    et al.
    SMHI, Samhälle och säkerhet.
    Hansson, Martin
    SMHI, Samhälle och säkerhet.
    Bjurström, Joel
    Simonsson, Daniel
    Naturtypsbestämning av miljöövervakningsstationer SMHI pelagial miljöövervakning2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Provtagningsstationerna i den nationella miljöövervakningen i havsmiljö är inte naturtypsbestämda. Detta innebär att insamlad miljöövervakningsdata inte kan användas fullt ut till bedömningar för artikel 17, art- och habitatdirektivet, samt för havsmiljödirektivet.  HaV har finansierat och uppdragit åt SMHI att undersöka möjligheterna att på ett enkelt sätt naturtypsklassa de månatliga miljöövervakningsstationerna som SMHI provtar. Uppdraget avsåg att testa utrustning och med hjälp av dropvideo undersöka om det är möjligt att, och i så fall, naturtypsbestämma stationer i utsjön under decemberexpeditionen 2016.  SMHI har konstruerat en rigg och utfört provtagning på 11 av 25 miljöövervakningsstationer. Belysningsproblematik och väder reducerade antalet provtagna stationer. SMHI anser att riggen, med justerad ljuskälla, är ett bra verktyg för visuell registrering av naturtyp på miljöövervakningsstationerna i utsjön.  Dock föreslås ett antal justeringar av riggen för att öka kvalitén på bildmaterialet samt att öka möjligheten att utföra ytterligare bedömningar av bildmaterialet.  Merparten av de undersökta bottnarna visar på väldigt finkornigt materiel, likt silt/lera. Ett fåtal arter har registrerats och ingen större mängd växtlighet. Merparten av de undersökta stationerna uppfyllde inte kriteriet för någon av habitatdirektivets naturtyper. På två stationer har naturtyp registreras som 1160 Vikar och sund, innehållandes1110 Sandbankar. För HUB Underwater biotopes har AB.H3O Baltic aphotic muddy sediment characterized by infaunal echinoderms registrerats på stationen P2 och AB.M4U Baltic aphotic mixed substrate characterized by no macrocommunity på stationerna BY5 och BY4.  SMHI rekommenderar en genomgång av det insamlade materialet med ArtDatabanken och/eller ytterligare expert för att säkerställa bedömning, utföra vissa rekommendationer samt säkerställa material som ska rapporteras till datavärd.SMHI rekommenderar ytterligare visuell provtagning på resterande stationer, samt kompletterande provtagning på stationer där kvalité på bild eller ljus varit bristfällig, eller där ArtDatabanken eller möjlig ytterligare expert rekommenderar ytterligare provtagning. Ytterligare expert kan komma att rekommendera hugg som kompletterande provtagning till den visuella metoden.En visuell undersökning på samtliga 25 stationer, med en landning per station, uppskattas förlänga en expedition med ca 11,5-13,5 timmar. 

  • 35.
    Wesslander, Karin
    et al.
    SMHI, Samhälle och säkerhet.
    Viktorsson, Lena
    SMHI, Samhälle och säkerhet.
    Summary of the Swedish National Marine Monitoring 2016 - Hydrography, nutrients and phytoplankton2017Rapport (Annet vitenskapelig)
    Abstract [en]

    Results from the Swedish national marine monitoring in the pelagic during 2016 are presented. The institutes who conduct the national monitoring are SMHI (Swedish meteorological and hydrological institute), SU (Stockholm University) and UMF (Umeå marine sciences centre). The presented parameters in this report are; salinity, temperature, oxygen, dissolved inorganic phosphorous, total phosphorous, dissolved inorganic nitrogen, total nitrogen, dissolved silica, chlorophyll and phytoplankton. Secchi depth, zooplankton, humus, primary production, pH and alkalinity are also measured but not presented. Seasonal plots for surface waters are presented in Appendix I.  Time series for surface waters (0-10 m) and bottom waters are presented in Appendix II. The amount of nutrients in the sub-basins of the Baltic Sea is presented per season and year in Appendix III.Exceptional events 2016 

    • A warm September due to several high pressure systems, with temperatures more than one standard deviation above mean in almost all stations from Skagerrak, Kattegat and the Baltic Proper.
    • Low oxygen in Kattegat bottom water during autumn as can be seen in the seasonal plots for both Anholt E and Fladen.
    • Improved oxygen condition in the East Gotland Basin, due to an increased frequency of deep water inflows in comparison to the period 1983 until the large inflow in December 2014. The inflow of 30 km3 in the beginning of the year could be tracked in the deep water in the Eastern Gotland Basin in June.
    •  Elevated levels of silicate have been observed in the Baltic Sea since 2014 and the silicate levels were also elevated this year but mainly in the central and the northern parts of the Baltic Proper.
    • In July there were high cell numbers of the dinoflagellate Dinophysis acuminata, which caused high levels of toxins in blue mussels. During this period it was forbidden to harvest blue mussels along the Bohus coast.
    • Unusual long period of cyanobacteria bloom in the Baltic Sea.
  • 36.
    Wåhlström, Irene
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eilola, Kari
    SMHI, Forskningsavdelningen, Oceanografi.
    Edman, Moa
    SMHI, Forskningsavdelningen, Oceanografi.
    Almroth-Rosell, Elin
    SMHI, Forskningsavdelningen, Oceanografi.
    Evaluation of open sea boundary conditions for the coastal zone. A model study in the northern part of the Baltic Proper.2017Rapport (Annet vitenskapelig)
    Abstract [en]

    The environmental conditions in the coastal zone are strongly connected with the conditions in the open sea as the transports across the boundaries are extensive. Therefore, it is of critical importance that coastal zone models have lateral boundary forcing of high quality and required parameters with good coverage in space and time.

    The Swedish Coastal zone Model (SCM) is developed at SMHI to calculate water quality in the coastal zone. This model is currently forced by the outcome from a one-dimensional model, assimilated to observations along the coast. However, these observations are scarce both in space, time and do usually not include all required parameters. In addition, the variability closer to the coast may be underestimated by the open sea monitoring stations used for the data assimilation. These problems are partly overcome by utilize the one-dimensional model that resolves all the variables used in the SCM. However, the method is not applicable for examine either the past period or future scenario where the latter analyze how climate change might affect the coastal zone. In the present study, we therefore evaluate the possibility to use results from a three-dimensional coupled physical and biogeochemical model of the Baltic Sea as open sea boundary conditions for the coastal zone, primarily to investigate the two periods mentioned above.

    Seven sensitivity experiments have been carried out in a pilot area of the coastal zone, the northern part of the Baltic proper, including the Stockholm Archipelago. The sensitivity tests were performed in order to explore methods to extract the outcome from the three-dimensional model, RCO-SCOBI, and apply as lateral boundary forcing for the SCM. RCO-SCOBI is a model for the open Baltic Sea with high horizontal and vertical resolution of the required variables. The results from the different tests were examined and evaluated against observations in the coastal zone. This was executed for both the physical and the biogeochemical variables utilizing a statistical method.

    The results from this study concluded that the outcome from the RCO-SCOBI is applicable as forcing files for the SCM. The best results in the tests was obtained with a method extracting depth profiles for the required variables from the RCO-SCOBI at a position 10 nautical miles to the east and 10 nautical miles to the south in the Baltic proper or north in the Gulf of Bothnia outside each of the outer basins.

  • 37.
    Stensen, Katarina
    et al.
    SMHI, Samhälle och säkerhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Eklund, Anna
    SMHI, Samhälle och säkerhet.
    Vattentemperaturer och is i Mälaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Denna rapport presenterar hur vattentemperatur och is beräknas förändras i Mälaren tillmitten av seklet och fram till 2100 på grund av den globala uppvärmningen.Beräkningarna är gjorda med en sjömodell där Mälaren är uppdelad i två bassänger. Dekallas västra Mälaren och östra Mälaren.De tydligaste förändringarna i Mälaren i ett framtida klimat beräknas bli högrevattentemperaturer både på ytan och på botten samt kortare period med is. Iberäkningarna har två framtidsscenarier använts, vilka baseras på mängden växthusgaser iatmosfären. I det högre scenariot, vilket motsvarar fortsatta utsläpp med dagensutsläppsnivåer, ökar vattentemperaturen mer jämfört med scenariot där utsläppen avväxthusgaser är begränsade.Sammanfattning av resultaten för klimatscenarierna: Den årliga perioden som Mälaren är täckt med is beräknas minska med enmånad till två månader mot slutet av seklet. Ytvattnets medeltemperatur beräknas öka 1,5 till 2,5 grader för bådabassängerna. Förändringen är ungefär lika stor under hela året. Bottenvattnets medeltemperatur väntas öka mellan 1 till 2 grader i den grundarevästra bassängen och 0,5 till 1,5 grader i den djupare östra bassängen.Förändringen är ungefär lika stor under hela året. Maxtemperaturen ökar något mer än medeltemperaturen för både ytvatten ochbottenvatten. Den period som ytvattnets dygnsmedeltemperatur är över 20 grader, ökar medcirka en månad upp till en och en halv månad.Medeltemperaturen och maxtemperaturen för dagens klimat är beräknad utifråntidsperioden 1997-2015 och utifrån 2032-2050 och 2080-2098 för ett framtida klimat.Maxtemperaturen är det högsta värdet som beräknas uppnås under perioden.

  • 38.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    German, Jonas
    SMHI.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Harbman, Ulrika
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vänern. Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vänern fram till 2100 på grund av den globala uppvärmningen. De tydligaste förändringarna i Vänern och Göta älv i ett framtida klimat beräknas bli att:  Det blir vanligare med låga nivåer i Vänern.  Det blir vanligare med höga nivåer i Vänern.  Det blir vanligare med låga tappningar i Göta älv.  Det blir vanligare med höga tappningar i Göta älv.  Det blir högre vattentemperaturer.  Det blir kortare perioder med is. I denna rapport redovisas nya beräkningar för Vänerns nivåer som ersätter de tidigare beräkningarna från 2010 (Bergström m.fl. 2010).

  • 39.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    German, Jonas
    SMHI.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Rasmusson, Maria
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Vättern Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Vättern fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Vättern i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • Det blir mindre vanligt med höga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta vattennivå) väntas bli oförändrade.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is.

    I ett varmare klimat beräknas avdunstningen öka, både från växtligheten i Vätterns tillrinningssområde och direkt från sjöns yta. Det gör att vattennivån i Vättern väntas ligga på en lägre nivå i framtiden. Enligt beräkningarna väntas medelvattennivån i Vättern minska med ca en till två decimeter till slutet av seklet, med ungefär lika stor minskning under alla årstider.Antal dagar per år med nivåer under sänkningsgränsen 88,3 m väntas öka från dagens ca 1,5 månad till ca 3 månader i mitten av seklet och 4-6 månader i slutet av seklet. De allra högsta nivåerna, beräknad högsta vattennivå, beräknas vara oförändrade i framtiden.Vattentemperaturen i Vätterns ytvatten väntas öka med ca en grad till mitten av seklet och ca 1,5 till 3 grader till slutet av seklet. Bottenvattnets temperatur väntas inte förändras till mitten av seklet men öka med upp till en grad i slutet av seklet.Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka en vecka per år till cirka två veckor i mitten av seklet och upp till 6 veckor i slutet av seklet. Antalet år då Vättern är islagd beräknas minska kraftigt till slutet av seklet.

  • 40.
    Eklund, Anna
    et al.
    SMHI, Samhälle och säkerhet.
    Johnell, Anna
    SMHI, Affärsverksamhet.
    Tofeldt, Linda
    SMHI, Affärsverksamhet.
    Tengdelius Brunell, Johanna
    SMHI, Affärsverksamhet.
    Andersson, Maria
    SMHI, Affärsverksamhet.
    Ivarsson, Cajsa-Lisa
    SMHI, Affärsverksamhet.
    German, Jonas
    SMHI.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Andersson, Elinor
    SMHI, Samhälle och säkerhet.
    Vattennivåer, tappningar, vattentemperaturer och is i Hjälmaren Beräkningar för dagens och framtidens klimatförhållanden2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Beräkningar har gjorts för hur vattennivåer, tappningar, vattentemperatur och is beräknas förändras i Hjälmaren fram till 2100 på grund av den globala uppvärmningen.De tydligaste förändringarna i Hjälmaren i ett framtida klimat väntas bli att:

    • Det blir vanligare med låga nivåer.
    • De allra högsta nivåerna (så kallad beräknad högsta nivå) väntas öka något.
    • Det blir högre vattentemperaturer.
    • Det blir kortare period med is

    Vattennivån i Hjälmaren väntas förändras måttligt i framtida klimat. Den tydligaste förändringen är att det vänas bli vanligare med låga nivåer, främst under sommar och höst. Detta är en följd av att avdunstningen, både från växtligheten i Hjälmarens avrinningsområde och direkt från sjön, beräknas öka i framtiden. I dagens klimat är vattennivån lägre än 21, 6 m (vilket motsvarar Hjälmarens sänkningsgräns) under i genomsnitt en månad per år. I framtiden väntas nivån vara lägre än 21,6 m under ca 3,5 månader.

    För de allra högsta nivåerna (beräknad högsta vattennivå) syns en ökning för det kraftigaste utsläppsscenariot (RCP8.5) medan förändringarna är små för scenariot med begränsade utsläpp av växthusgaser (RCP4.5).Vattentemperaturen i Hjälmaren väntas öka med cirka en halv grad till mitten av seklet och mellan 1 och 2,5 grader till slutet av seklet. Antal dagar per år med ytvattentemperaturer över 20 grader beräknas öka från dagens cirka sju veckor per år till cirka 9 veckor i mitten av seklet och upp till 12 veckor i slutet av seklet. I dagens klimat är Hjälmaren islagd varje vinter. I framtida klimat väntas isläggningen utebli vissa vintrar.

  • 41.
    Persson, Gunn
    et al.
    SMHI, Affärsverksamhet.
    Nylén, Linda
    SMHI, Affärsverksamhet.
    Berggreen-Clausen, Steve
    SMHI, Affärsverksamhet.
    Berg, Peter
    SMHI, Forskningsavdelningen, Klimatforskning - Rossby Centre.
    Rayner, David
    SMHI.
    Sjökvist, Elin
    SMHI, Affärsverksamhet.
    Från utsläppsscenarier till lokal nederbörd och översvämningsrisker2016Rapport (Annet vitenskapelig)
    Abstract [sv]

    Inom det av MSB finansierade projektet ”Nederbörd och översvämningar i ramtidens Sverige - ett system till stöd för klimatanpassning” har SMHI ansvarat för hydrologisk och hydraulisk modellering samt framtagande av tidsserier med lokalt klimat för framtida förhållanden. Två metoder att bearbeta klimatdata har använts; SMHI:s Distributionsbaserad skalering (DBS) och en statistisk metod utarbetad vid Göteborgs universitet.

  • 42.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2016 - Extent of Anoxia and Hypoxia, 1960-20162016Rapport (Annet vitenskapelig)
  • 43.
    Höglund, Anders
    SMHI, Forskningsavdelningen, Oceanografi.
    Invasive species in the Baltic Sea A model study of plankton transport2016Rapport (Annet vitenskapelig)
    Abstract [en]

    In this report, an ensemble of releases of passive particles at locations close to some

    selected ports around the Baltic Sea and Kattegat are modelled. The particles are

    transported with the currents. Maps of particle densities at 2, 4, 8, 16, 32 and 52

    weeks after the release are presented.

    The results indicate that many basins are narrow enough for the particles to cross

    from shore to shore within two weeks, e.g., in the Kattegat, Gulf of Finland and

    Kvarken. The results also show an asymmetry in the transport between different

    locations, which means that particles released from one location to another require

    substantially more time to reach the other location, if at all, than particles going

    in the opposite direction. Some potential barriers to transport are identified and

    discussed.

  • 44.
    Andersson, Helén
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eriksson Bram, Lena
    SMHI, Samhälle och säkerhet.
    Hjerdt, Niclas
    SMHI, Samhälle och säkerhet.
    Lindström, Göran
    SMHI, Forskningsavdelningen, Hydrologi.
    Löptien, Ulrike
    SMHI, Forskningsavdelningen, Oceanografi.
    Strömqvist, Johan
    SMHI, Forskningsavdelningen, Hydrologi.
    Översikt av beräkningsmodeller för bedömning av fiskodlingars näringsämnesbelastning på sjöar, vattendrag, magasin och kustvatten2016Rapport (Annet vitenskapelig)
    Abstract [sv]

    Den här rapporten är en kunskapssammanställning som utförts av SMHI på uppdrag av Havs- och Vattenmyndigheten. Den utgör inte något ställningstagande från Havs- och vattenmyndighetens sida. Rapporten försöker att sammanfatta den problematik som associeras med näringsämnesbelastningar från fiskodlingar i öppna kassar, vilka typer av beräkningar som kan behöva göras för att få en uppfattning om hur dessa kan påverka miljön samt några olika typer av modeller för detta ändamål.

    Fisk-, alg- och skaldjursodling är en växande industri runt om i världen som kan ge såväl näringsrik och hälsosam mat som arbetstillfällen. En nackdel med framförallt fiskodling i öppna kassar är att den kan innebära en påfrestning för vattenmiljön. De näringsämnen som ofta släpps ut från odlingen kan bidra till den övergödningsproblematik som redan finns i många sjöar och havsområden. Det är därför av största vikt att få en god uppskattning av den förväntade storleken på utsläppen förknippade med en öppen odling samt hur de kan tänkas förändra vattenkvaliteten på odlingsplatsen och dess närhet. Beräkningsmodeller kan vara till god hjälp vid bedömningen.

    Fiskar utsöndrar lösta näringsämnen och från odlingskassarna faller det också ut partikulärt organiskt material i form av fekalier och oätet foder. Storleken på näringsämneskällorna behöver beräknas och det finns modeller av olika komplexitet för att uppskatta detta. Storleken på det partikulära avfallet är viktigt dels för att det bidrarmed näringsämnen till vattnet och dels för att det kan ge upphov till ansamlingar av organiskt material på bottnen. När det organiska materialet bryts ner förbrukas syre och om ansamlingarna blir omfattande finns en risk för att det uppstår syrebrist vid bottnen. Om svavelväte bildas kan det orsaka skador på såväl den odlade fisken som det lokala ekosystemet. Odlingen kan också bidra till en försämrad vattenkvalitet i sin omgivning genom att tillgången av lösta näringsämnen blir större och därmed ge en ökad algproduktion. Den ökade algproduktionen skall i sin tur brytas ner och kan i förlängningen bidra till syrebristproblematiken.

    Det finns ett antal modeller som är specifikt utvecklade för fiskodlingar i öppna kassar och de tar i olika hög grad upp den beskrivna problematiken. Rapporten innehåller detaljerade genomgångar av några av modeller för att visa på styrkor och svagheter kring olika angreppsätt. Den innehåller också sammanfattningar av några vanligt förekommande modeller som använts internationellt vid bedömning av fiskodlingars miljöpåverkan. För att minska den negativa påverkan på vattenmiljön från har det också utvecklats recirkulerande system för odling. Rapporten tar inte upp belastning från den typen av fiskodlingar. Om utsläppen från ett sådant system är känt kan dock vattenkvalitetsmodeller användas för att se effekten av utsläpp från en punktkälla.

    Rapporten sammanfattar ett antal vattenkvalitetsmodeller för sjöar, vattendrag, kust och hav. En vattenkvalitetsmodell behöver inte nödvändigtvis vara utvecklad för att beskriva konsekvenser av fiskodlingar men bör kunna hantera frågeställningar som uppkommer vid bedömningar av övergödningsrisk vid utsläpp från en punktkälla. Den behöver därför kunna simulera parametrar såsom förändringen av näringsämneskoncentrationer, primärproduktion, siktdjup och syrgashalter på olika nivåer i vattenmassan. Modeller för den här typen av uppskattningar finns också i olika komplexitetsgrad och för olika skalor i tid och rum.

    Vid modellering är en god tillgång till observationer en förutsättning för pålitliga modellresultat och behövs såväl för att driva och kalibrera modellen som för validering av modellresultaten. Det är viktigt att tillgängliga data håller god kvalitet. En noggrann analys och beskrivning av den tillgängliga databasen hjälper därmed till att bedöma tillförlitligheten av modellsimuleringarna.

  • 45.
    Andreasson, Arnold
    et al.
    Arnold Andreasson Konsult AB.
    Strömberg, Patrik
    SMHI, Samhälle och säkerhet.
    Prager, Maria
    SMHI, Samhälle och säkerhet.
    Nexelius, Nils
    SMHI, Samhälle och säkerhet.
    Automatisering av nationellt dataflöde till ICES genom skördning - en förstudie2016Rapport (Annet vitenskapelig)
    Abstract [sv]

    SMHI är, på uppdrag av Havs- och vattenmyndigheten (HaV), datavärd för svenska marina miljöövervakningsdata. En central del i uppdraget är att årligen rapportera nationellt insamlad data till nternationella Havsforskningsrådet, ICES.

    För biologiska data sker en årlig rapportering av data levererade från föregående års övervakning. Leveranserna sker på ett format definierat av ICES. Leveransernas innehåll valideras av SMHI mot ICES valideringstjänst DATSU via uppladdning till en webbsida. När samtliga fel är rättade skickas leveranserna till ICES via e-post.

    SMHI har fått ett uppdrag från HaV att utreda om det finns en möjlighet att låta ICES skörda data som ersättning för den nuvarande hanteringen med manuella leveranser. ICES har också ett intresse av att utreda om skördning av data är en lämplig metod för framtida inhämtande av data. ICES vill även testa möjligheterna att byta leveransformat till ett nytt XML-baserat format.

    SMHI föreslår en lösning där SMHI:s tjänst för maskin-maskin-kommunikation, SHARKdata, används. SHARKdata kommer att utökas för att kunna generera exportpaket i enlighet med ICES nya XML-baserade format. ICES har även kompletterat sin valideringstjänst DATSU med ett gränssnitt för maskin-maskinkommunikation så att man med automatik kan anropa DATSU och validera exportpaket. En prototyp har utvecklats för att visa hur SHARKdata kan användas för denna typ av hantering med skördning. I prototypen ingår även konvertering till en inledande testversion av XML-formatet för datatypen Zoobenthos.

    Det fortsatta projektet efter denna förstudie planeras som ett samarbete mellan SMHI och ICES. SMHI utvecklar fortlöpande SHARKdata i takt med att ICES släpper specifikationer på format för nya datatyper, parallellt med att data rapporteras på nuvarande sätt. Detta arbete beräknas pågå under 2016 och 2017, med varierande intensitet. Efter denna test- och utvecklingsperiod antas ICES släppa en ny version av sitt rapporteringformat och då kan SMHI gå över till det nya rapporteringssättet.

  • 46.
    Kuznetsov, Ivan
    et al.
    SMHI, Forskningsavdelningen, Oceanografi.
    Eilola, Kari
    SMHI, Forskningsavdelningen, Oceanografi.
    Dieterich, Christian
    SMHI, Forskningsavdelningen, Oceanografi.
    Hordoir, Robinson
    SMHI, Forskningsavdelningen, Oceanografi.
    Axell, Lars
    SMHI, Forskningsavdelningen, Oceanografi.
    Höglund, Anders
    SMHI, Forskningsavdelningen, Oceanografi.
    Schimanke, Semjon
    SMHI, Forskningsavdelningen, Oceanografi.
    Model study on the variability of ecosystem parameters in the Skagerrak-Kattegat area, effect of load reduction in the North Sea and possible effect of BSAP on Skagerrak-Kattegat area2016Rapport (Annet vitenskapelig)
    Abstract [en]

    Newly developed ecosystem model NEMO-Nordic-SCOBI was applied to Skagerrak - Kattegat area to investigate the variability of some indicators of the ecosystem. Also, two sensitivity runs were performed to investigate possible effect of the Baltic Sea Action Plan (BSAP) and a river loads reduction scenario on the Skagerrak - Kattegat area. The performed investigation could be used “to provide a basis to assist with the interpretation of measurement data before the Intermediate Assessments Eutrophication status assessment”. Comparison of simulation results with observations indicates acceptable model performance. Modeled sea surface salinity, temperature and dissolved inorganic phosphate (DIP) are in good agreement with observations. At the same time, the model has a bias in certain areas of the investigated region for dissolved inorganic nitrogen (DIN) and dissolved silicate during the winter season. However, the model in its current state shows good enough results for the performed investigation. Results of the two sensitivity studies show a decrease of sea surface nutrients concentrations during winter period in both regions. In the Skagerrak area the decrease is due to reduction in river nutrient loads in North Sea. In the Kattegat area there is a decrease of dissolved phosphate due to the implementation of BSAP. At the same time, in both scenarios, no significant changes were obtained for near bottom oxygen or surface layer Chl-a.

  • 47.
    Johansson, Johannes
    et al.
    SMHI, Samhälle och säkerhet.
    Hansson, Martin
    SMHI, Samhälle och säkerhet.
    Slutrapport 2015 för uppdraget ”Databaslagring av historiska fys/kemdata från Stockholm Vatten”: Datavärdskapet Oceanografi och Marinbiologi2016Rapport (Annet vitenskapelig)
    Abstract [sv]

    SMHI är datavärd för marinbiologiska och oceanografiska data på uppdrag av Havs- och vattenmyndigheten. I detta uppdrag från Havs- och vattenmyndigheten som är kopplat till datavärdskapet har datavärden genomfört databasläggning av fysikaliska och kemiska data från Stockholm Vatten AB. Arbetet har omfattat två stora dataset som täcker två perioder; 1968-1981 och 1982-2012.

  • 48.
    Josefsson, Weine
    et al.
    SMHI, Samhälle och säkerhet.
    Ottosson Löfvenius, Mikaell
    Perrnilla, Löfvenius
    Measurements of total ozone 2012-20152016Rapport (Annet vitenskapelig)
    Abstract [en]

    This report summarises the quality control, quality assurance and measurements of total

    ozone at Norrköping and Vindeln for the period 2012-2015. Significant incidents affecting the

    measurements are documented. Daily data are listed and plotted.

    This work was supported by the Swedish Environmental Protection Agency.

  • 49.
    Engardt, Magnuz
    et al.
    SMHI, Forskningsavdelningen, Luftmiljö.
    Alpfjord, Helene
    SMHI, Affärsverksamhet.
    Andersson, Camilla
    SMHI, Forskningsavdelningen, Luftmiljö.
    PODY-beräkningar med MATCH Sverigesystemet2016Rapport (Annet vitenskapelig)
    Abstract [sv]

    Vi har utvecklat ett programpaket som möjliggör PODY beräkningar i MATCH Sverigesystemet. Rapporten ger en kortfattad introduktion till PODY och går igenom implementeringen i MATCH-systemet.

    Resultat för receptorerna generic crops (POD3gen-CR) och generic deciduous trees (POD1gen-DT) presenteras för åren 2013-2015 och jämförs med motsvarande data från EMEP-modellen. POD3gen-CR uppvisar stor år-till-år variation och MATCH-resultaten är tydligt högre än motsvarande uppskattningar av EMEP-modellen. POD1gen-DT varierar mindre från år till år och resultaten från MATCH och EMEP-modellen överensstämmer bättre.

    PODY presenteras tillsammans med övriga ozonmått på SMHI:s miljöövervakningssida (www.smhi.se/klimatdata/miljo/atmosfarskemi) med start från miljöövervakningsåret 2013.

  • 50.
    Hansson, Martin
    et al.
    SMHI, Samhälle och säkerhet.
    Andersson, Lars
    SMHI, Samhälle och säkerhet.
    Oxygen Survey in the Baltic Sea 2015: Extent of Anoxia and Hypoxia, 1960-2015. The major inflow in December 20142016Rapport (Annet vitenskapelig)
    Abstract [sv]

    En klimatologisk atlas över syresituationen i Östersjöns djupvatten publicerades 2011 i SMHIs Report Oceanography No 42. Sedan 2011 har årliga uppdateringar gjorts då kompletterande data från länder runt Östersjön har rapporerats till ICES. I denna rapport har resultaten från 2014 uppdaterats. De preliminära resultaten för 2015 baseras på data insamlade under Baltic International Acoustic Survey (BIAS) och nationell miljöövervakning med bidrag från Sverige, Finland, Estland, Tyskland och Polen. Förekomsten av hypoxi (syrebrist) och anoxi (helt syrefria förhållanden) under höstperioden, augusti till oktober, har undersökts i varje mätprofil. Djupet där hypoxi eller anoxi först påträffas i en profil har interpolerats mellan provtagningsstationer och kombinerats med en djupdatabas för beräkning av utbredning och volym av hypoxiska och anoxiska förhållanden. Resultaten har överförts till kartor och diagram för att visualisera syresituationen i Östersjöns djupvatten. Resultaten för 2014 och de preliminära resultaten för 2015 visar att de extrema syreförhållanden som observerats i Egentliga Östersjön fortsätter. Utbredningen av anoxi fortsätter att vara konstant förhöjd till nivåer som bara observerats i Östersjön enstaka år före 1999. Trots det stora inflöde som inträffade i december 2014 beräknas ungefär 16% av bottnarna i Egentliga Östersjön, Finska viken och Rigabukten vara påverkade av anoxiska förhållanden och omkring 29% av hypoxi.

1234567 1 - 50 of 700
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
v. 2.35.7
|